(data stored in ACNUC7421 zone)

EMBL: CP001115.PE109

CP001115.PE109       Location/Qualifiers
FT   CDS_pept        150203..150598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00915"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00915"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47501"
FT                   /db_xref="UniProtKB/TrEMBL:C1D262"
FT                   /protein_id="ACO47501.2"
FT                   /translation="MLHPSAEKAVLLPEGFACALFTVAASGEAKRQNMGSLPVMMNGTD
FT                   TPSQGMKHTLINVWPSYAYEAVPNTWARVYQEIKSSSKNGSRLFLRCSLTEFLIAQRHL
FT                   YAIEAESSREAGARRLLYKSRGNKVSL"
     atgcttcatc catccgccga aaaagcggtt ttgcttccag agggctttgc ctgcgccctc        60
     ttcacagtcg cggcctcagg cgaagcaaag cggcagaaca tggggtcgct gccagtgatg       120
     atgaatggta cagacactcc atctcaggga atgaagcaca cactgataaa cgtctggccc       180
     tcctacgctt atgaagctgt gccgaacact tgggcgcgag tgtaccagga aataaagtct       240
     tcctctaaaa acggaagcag actttttctg cggtgctctc tcactgaatt ccttatcgcc       300
     caacggcacc tctatgcgat tgaggccgaa agttccagag aggctggtgc ccggcgtctt       360
     ctatataaga gtcgtggcaa caaggtctcc ttgtga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page