(data stored in ACNUC7421 zone)

EMBL: CP001115.PE11

CP001115.PE11        Location/Qualifiers
FT   CDS_pept        complement(11702..12895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00094"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00094"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47401"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1W2"
FT                   /protein_id="ACO47401.1"
FT                   /translation="MKRLLFLLCLTLPLSSAPLAAAQASAVNDPKLTHAFRTALLDAER
FT                   VWLSTNPDRSFLSVGNDLEYALGWLKSGKYVEAMTPLGLIGAKGADDPFVHLFTAFALA
FT                   GQGKAHEAQGALANAVRRLPALQAYTPTITAYVRAAASPAPSQDAPKPATQPVGPQPSS
FT                   PLNASTVKSMGAALNEAERLWKATRPSTGMFSTNWHVEQILYNLRNQNPEGAKIQIDAA
FT                   RSALKQTAQSETDRAFLDLLDAFAAAQRGQRTLVGQALSALATSPHSTGLKPLTEFLRT
FT                   YQPPKAAPAPVKTPDAKPGGPLMGGSYSCWLERPGINGTRNDVPRGTLTLKTNGTYTYM
FT                   GKGGTYRYNAQTGLLVFTSGFFTNPVPERTTFIKHPRTAQIDIHWAYANDWSCGMNY"
     atgaaacgcc tgttgttcct tctgtgcctg actcttcccc tcagctctgc tcccctggcg        60
     gctgcccaag ccagtgccgt aaatgatccg aagctcacgc atgctttccg cactgcactg       120
     ctggacgccg aacgggtctg gctgtctacc aaccccgacc ggtccttcct gagcgtaggg       180
     aacgaccttg agtatgctct cgggtggctc aagagcggca aatacgtgga ggccatgacc       240
     ccgctgggcc tgattggcgc aaagggcgcc gacgatccgt tcgtgcacct gtttactgcc       300
     tttgcactcg cagggcaggg caaggcccac gaagctcagg gagcgctcgc caacgctgtc       360
     cggcgcctgc ctgcccttca ggcctacacc ccgacgatta cggcttacgt ccgtgctgcc       420
     gcctcacctg cgccctcgca agatgcgcca aagccggcga ctcaacccgt tgggccacaa       480
     cccagcagcc cgctgaatgc cagcacagtc aagagtatgg gcgcagccct gaacgaagct       540
     gagcgcctct ggaaagctac acgtccatcg actggcatgt tcagtaccaa ctggcatgtc       600
     gaacagattc tgtataacct gcgcaaccag aatccagagg gagcaaagat acagattgac       660
     gctgcacgat cagctttgaa gcagactgcc cagagcgaaa ctgacagggc ctttctcgac       720
     cttctggatg cctttgctgc cgcacaacgg gggcagcgga ccctcgttgg tcaagccctg       780
     tctgctctcg ccacaagtcc ccacagcact ggccttaaac cgctgaccga atttcttcgc       840
     acctatcagc caccgaaagc agcgccggcg ccggtgaaga ccccggatgc caagcccgga       900
     ggaccattga tgggcgggag ctattcctgc tggttagaac gccctggaat aaacggaacc       960
     cgaaacgacg tgcccagggg aaccttgacc ctgaagacca acggtacata tacctatatg      1020
     ggcaaaggcg gaacctatcg ctacaacgcg cagacagggc ttctggtctt tacgagcggc      1080
     ttttttacta acccggttcc agagcgcacc acttttatca agcacccgcg aacagcacaa      1140
     atcgatattc attgggctta cgccaacgac tggtcctgtg gcatgaatta ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page