(data stored in ACNUC7421 zone)

EMBL: CP001115.PE112

CP001115.PE112       Location/Qualifiers
FT   CDS_pept        complement(151444..151746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00917"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00917"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47504"
FT                   /db_xref="GOA:C1D265"
FT                   /db_xref="UniProtKB/TrEMBL:C1D265"
FT                   /protein_id="ACO47504.1"
FT                   /translation="MFGFYWCAERGQQEPLQNTTGDGTSLRETLPAKSALYPTGSHGAF
FT                   PARSEHAMAAPGRLRRYKGMTLLTSVSIIIYAASLVGTTYNHVTDLWYKGCLPYD"
     atgttcggtt tctactggtg tgctgaacga ggccagcaag aacctttgca gaacactacg        60
     ggggacggaa ccagtctgcg tgaaactttg ccggctaaat ccgcacttta tccaaccggc       120
     agccatggcg ctttcccagc cagaagtgag catgccatgg cagctcctgg gagattgcgt       180
     cgctacaagg gtatgacttt gctcacgagt gtctctatta taatttacgc tgccagcttg       240
     gttgggacga cttataacca tgtgaccgat ctctggtata agggatgcct tccctatgat       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page