(data stored in ACNUC7421 zone)

EMBL: CP001115.PE117

CP001115.PE117       Location/Qualifiers
FT   CDS_pept        complement(161589..161813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00954"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00954"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26551"
FT                   /db_xref="GOA:X5HLK1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:X5HLK1"
FT                   /protein_id="AHX26551.1"
FT                   /translation="MASSSLSAVATHVLEFLQQEHQKPRSADELAALLQRDRAEVNRAL
FT                   EELQAAGLVAPEAVSGYGGNDTVWSVTHS"
     atggcctcat cgtcactgtc cgcagttgca acgcatgtcc ttgagtttct gcagcaggaa        60
     caccagaagc cccggagtgc agacgaattg gctgcgctgc tgcaacgtga ccgggcagag       120
     gttaaccgag cgctggagga acttcaggca gccgggcttg tcgcacccga agcggtcagt       180
     ggatacggcg gcaacgacac cgtgtggagt gtgacgcact cctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page