(data stored in ACNUC7421 zone)

EMBL: CP001115.PE118

CP001115.PE118       Location/Qualifiers
FT   CDS_pept        162411..163925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47509"
FT                   /db_xref="GOA:C1D270"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:C1D270"
FT                   /protein_id="ACO47509.1"
FT                   /translation="MSASTFQFDNTYARDLQGFYAPWKPAPVPSPSLLFFNRELALELG
FT                   LDPKVLDGPEGAAIFAGNQVPEGAEPLAQAYAGHQFGAFSPQLGDGRALLLGEVIDRLN
FT                   RRRDIMLKGSGRTPFSRGGDGKAAIGPMLREVLIGEAMHALGIPTTRALAVAGTGEPVY
FT                   REQPLPGAVLTRVAASHLRIGTFEYFNARGETQRVRQLADYAIARHDPDLEGTSDRYLA
FT                   LLRRVAQRQAELIAQWMNVGFIHGVMNTDNVTISGETIDYGPCAFMEAYDPDAVFSSID
FT                   HSGRYAYSNQPLIARWSLARFAETLLLLIAEDESKAAVSKAIGQATEVIDAFPEWYAAA
FT                   LLKGQRQKLGLQRSAGSDDEADRTLAADWLTLLHQHRVDFTLGWRRLADAAGGDDQPLR
FT                   ALFPYPQAPDAWLVRWRARLEREDGHALERSDRAERMRRVNPVVIPRNHRVEEALSAAS
FT                   EYEDLAPFTRLLTALKRPYDESQDQAEYTEPARTEVTACYRTFCGT"
     atgtctgctt ccacttttca gttcgacaac acctatgcac gggacctgca gggcttctac        60
     gcgccctgga aaccggctcc cgttccttcg ccgagcttgc tgttcttcaa ccgggaactg       120
     gcacttgagc tgggactgga tcccaaggta ctggacgggc ccgaaggtgc cgctatcttc       180
     gccggtaacc aggttcctga aggggccgaa ccgctcgcgc aggcctatgc cggacaccag       240
     ttcggcgcat tctcacctca actgggtgac gggcgggccc tgctgttggg cgaggttatc       300
     gatcggctca accggcgccg cgacatcatg ctcaaaggct cgggccgcac accgttttcg       360
     aggggaggcg acgggaaggc ggccattggc cccatgttgc gtgaggtgct gatcggcgaa       420
     gccatgcatg cgctcgggat cccgaccaca cgcgcacttg ccgtagcggg cacaggtgag       480
     cctgtctacc gcgagcagcc tctgcccggt gccgttctga ctcgcgtggc ggcgagccat       540
     ctgcgcatag gcacattcga gtacttcaac gcccgtggcg aaacgcaacg ggtccggcag       600
     cttgccgact acgccattgc ccggcatgat ccggatctcg aaggtaccag cgaccggtat       660
     cttgccctgc tgcggcgtgt ggcccagcgg caagcagaac tcattgccca gtggatgaat       720
     gtcggattca ttcacggcgt gatgaacacc gacaacgtaa cgatttccgg cgagacgatc       780
     gactacgggc cgtgtgcctt catggaagca tacgacccgg acgcggtgtt cagctccatt       840
     gaccatagtg ggcgctacgc ctacagcaac cagccgctca ttgcgcgctg gagtctggca       900
     cgctttgccg agaccctgct gctgcttatc gctgaagacg agagcaaagc cgccgtatca       960
     aaggccattg gtcaggcgac tgaggtgatc gatgcattcc ccgagtggta cgccgccgcg      1020
     ctgttgaaag gtcagagaca gaagctgggc ctgcaacgta gcgcggggag cgacgatgag      1080
     gcggaccgca cgctcgcagc cgactggctg acgctgctgc accaacaccg ggtggacttc      1140
     acccttgggt ggcgcaggct tgcagatgcg gcgggcggcg acgaccagcc gctccgggcc      1200
     ctctttcctt atccgcaggc tcccgacgcg tggcttgtcc gctggcgagc gcgcctcgag      1260
     cgcgaagacg gacatgccct ggaacggagt gaccgggccg agcgcatgcg ccgcgtcaac      1320
     ccggtggtca tcccgcgcaa ccaccgggtt gaggaagcgt tgtcggcggc ttctgaatac      1380
     gaggatctcg cccctttcac gcgcctgctg actgcgctga agcggcccta cgacgagtcg      1440
     caggatcagg ccgaatacac cgaaccggcc cgcactgagg taacagcctg ttaccgcacg      1500
     ttttgcggca cctga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page