(data stored in ACNUC7421 zone)

EMBL: CP001115.PE121

CP001115.PE121       Location/Qualifiers
FT   CDS_pept        complement(167533..167820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00985"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26552"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN76"
FT                   /protein_id="AHX26552.1"
FT                   /translation="MIPLSCGGATYEAEVRGNGTYTSGHITGSNSNLIPFGFGGQFIDR
FT                   ATGVSYSFMESKGGNRIGLQRSLMTCTLSYEDEMVSGQLTVTVFMTPGGK"
     gtgattcccc tgagctgcgg cggcgcaacg tatgaggccg aggtgagagg aaatggcacc        60
     tacacgtccg gtcatatcac cggttccaac agcaacctta tccccttcgg attcggcggt       120
     cagttcattg accgggcaac cggcgtttcc tactccttta tggaatcaaa gggaggaaac       180
     cggataggac tccagcggtc gctgatgacc tgcacgcttt cgtacgagga tgaaatggtg       240
     agcggccaac tgacagtgac cgtctttatg acccccggtg ggaagtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page