(data stored in ACNUC7421 zone)

EMBL: CP001115.PE122

CP001115.PE122       Location/Qualifiers
FT   CDS_pept        168049..168438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00991"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47512"
FT                   /db_xref="UniProtKB/TrEMBL:C1D273"
FT                   /protein_id="ACO47512.1"
FT                   /translation="MTVWYLHFCLGKMGSTEDDVTLLCQGHPEGGIADTMDEVRQVCSP
FT                   LELMTAGRSSGRGTSNALPSCSAFPTSPVTAEKLKSRAVTVPSLLLNPSRVGCPPTARP
FT                   MARWNFREDVRSIAELRVQGAVFQQ"
     atgactgttt ggtatctgca cttttgcttg ggaaagatgg ggtccacaga ggatgacgtc        60
     actctgcttt gccaagggca ccctgaaggc ggaatcgcag ataccatgga tgaggttcgt       120
     caggtctgct cacccctgga acttatgact gctggtagat catcaggaag aggtacttca       180
     aatgcccttc cttcatgtag cgcttttcca acgtcaccgg taacagcaga gaagctgaag       240
     tccagagcag tgactgtccc gagtctcctt ctgaacccaa gccgagtagg ctgcccaccc       300
     acggccaggc ccatggccag atggaacttt cgagaagacg tgcgctcaat cgcggaactt       360
     cgcgttcagg gcgctgtatt ccagcagtga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page