(data stored in ACNUC7421 zone)

EMBL: CP001115.PE123

CP001115.PE123       Location/Qualifiers
FT   CDS_pept        168602..168934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00992"
FT                   /product="putative rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00992"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47513"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1D274"
FT                   /protein_id="ACO47513.2"
FT                   /translation="MKRLTPKELNTLNSSRKAPVTVDVRSSEEFEAGHVDGALNIPITD
FT                   LPQRLGELPKDRPVVTYCNMFHPGASRGEKAAAQLLELGFDAGVLEGGYPAWKDAGAAD
FT                   PAPENK"
     atgaaacggc tgacacccaa ggagctcaac acactcaaca gcagccggaa ggcgcccgtc        60
     actgtggatg tgcggagctc agaagaattc gaggcgggtc atgtggacgg tgccttgaac       120
     atccccatta cagaccttcc gcagcgactg ggagagcttc caaaagaccg tccggtggtc       180
     acgtattgca acatgttcca cccgggagcg tcgcgaggcg agaaagcggc ggcgcagctg       240
     ctggaactgg ggtttgatgc tggagtgctg gagggtggat accccgcatg gaaggatgcg       300
     ggtgcagctg acccagcgcc ggaaaacaag tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page