(data stored in ACNUC7421 zone)

EMBL: CP001115.PE126

CP001115.PE126       Location/Qualifiers
FT   CDS_pept        172209..172547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00997"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00997"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47517"
FT                   /db_xref="UniProtKB/TrEMBL:C1D278"
FT                   /protein_id="ACO47517.1"
FT                   /translation="MCGKKRLAYAWRRVRRRPLTARLRKCMFNGQPLDKAAASKASCNT
FT                   DSAIGWISGVPEVGQGASEPGGGGVTQISSRANVHPGRRGKGQQFSPRPFRGIDFSSSG
FT                   TTAVDVGA"
     gtgtgcggga agaagcgact cgcttacgca tggcgccgtg tacgacgccg accgctcacg        60
     gcacgcttgc ggaagtgcat gttcaatggt cagcctctcg acaaggcagc ggcatcaaag       120
     gcgtcatgca atacagactc agcgatcgga tggatcagcg gagtaccaga agtcggtcag       180
     ggtgcctccg aacccggtgg tgggggtgtg acccagatca gttcccgggc caacgtccac       240
     ccaggacgta ggggcaaggg tcagcagttc agcccccgac cgtttcgggg aatagacttt       300
     tcttcgtcag gcacaacggc ggtggacgtt ggagcgtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page