(data stored in ACNUC7421 zone)

EMBL: CP001115.PE127

CP001115.PE127       Location/Qualifiers
FT   CDS_pept        172766..173236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01000"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47518"
FT                   /db_xref="GOA:C1D279"
FT                   /db_xref="UniProtKB/TrEMBL:C1D279"
FT                   /protein_id="ACO47518.1"
FT                   /translation="MHNAPMYVTLRNTLSSLGITLGLPVMVLSPNLFWTQFSLADHLGE
FT                   GSVGITRAYVLAMLVPVAYGLWDALTRRDRSILGLYAMGRTLIGGAAASGLWTASGTRS
FT                   KPQWMCSCRRWCSWGVRCLEGHCLNPSSSKGSSSRCRQRSVTHCKKPWSTAV"
     gtgcacaatg caccgatgta cgtcacgctg cgcaacaccc tgtcgagctt gggcatcacg        60
     ttgggccttc ccgtgatggt attgagcccc aacctcttct ggacgcagtt cagcctggcc       120
     gaccacctgg gtgagggttc ggtgggcatc acgcgagcat atgtgctggc catgctggtg       180
     cccgtggcgt acggactctg ggatgccctg acgcgccgtg accggtcgat tctcgggctg       240
     tacgccatgg gcaggaccct gatcggcggc gcggcggctt ctggtttgtg gacggcctct       300
     ggtacgcgtt caaaaccgca atggatgtgt tcttgcaggc gctggtgttc ctggggagtg       360
     cggtgtttgg aaggccactg cttaaacccc tcatcgtcga agggctcatc aagcaggtgc       420
     cggcagcgca gcgtcacgca ctgcaagaag ccttggagca ccgcggtatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page