(data stored in ACNUC7421 zone)

EMBL: CP001115.PE128

CP001115.PE128       Location/Qualifiers
FT   CDS_pept        173086..173538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01001"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01001"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47519"
FT                   /db_xref="GOA:C1D280"
FT                   /db_xref="UniProtKB/TrEMBL:C1D280"
FT                   /protein_id="ACO47519.1"
FT                   /translation="MDVFLQALVFLGSAVFGRPLLKPLIVEGLIKQVPAAQRHALQEAL
FT                   EHRGMTRAYWLSGVIAGVWKLMFGGLRMLVAYSVVTAPFGTATFNAQVAVLMTVMYLPG
FT                   LLMGAIVLAPAMLLVDRTVKRIYGPDVTLMRSEGLHSFARNLTPAT"
     atggatgtgt tcttgcaggc gctggtgttc ctggggagtg cggtgtttgg aaggccactg        60
     cttaaacccc tcatcgtcga agggctcatc aagcaggtgc cggcagcgca gcgtcacgca       120
     ctgcaagaag ccttggagca ccgcggtatg acacgcgcgt actggctgag cggggtgatc       180
     gcaggcgtct ggaagctgat gttcggcggc ctccgaatgc ttgtcgcgta cagcgttgtg       240
     acggccccgt tcggcacggc gacgttcaat gcgcaggtgg cggtcctgat gaccgtgatg       300
     tacctacctg gtctgcttat gggagcgatt gtgctcgccc cggcgatgct gctggtagac       360
     cggacagtga aaagaatcta cggtccggac gtgaccttga tgcgctcgga agggctccac       420
     agttttgcgc ggaacctgac cccagccacc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page