(data stored in ACNUC7421 zone)

EMBL: CP001115.PE132

CP001115.PE132       Location/Qualifiers
FT   CDS_pept        179157..179411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01027"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26553"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5U5"
FT                   /protein_id="AHX26553.1"
FT                   /translation="MRNTPDFKSLYMPFDALLFFGDLGDGDLVGSIEQRHTRMNMRLDR
FT                   GWNALIRIHRWTGREGKTSLSEVTWVALSPAVMERWIVR"
     atgcgcaata cgcctgactt taagtcgttg tacatgccgt tcgacgccct cttgtttttt        60
     ggtgatcttg gggacggcga tttggtcggg tccattgagc agcgtcacac ccggatgaac       120
     atgcgcctcg accggggctg gaacgcgctg atccggattc accgctggac tgggcgagaa       180
     ggaaagacct ccttgagcga agtcacgtgg gtggccctgt cacccgccgt gatggaacgc       240
     tggattgtgc gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page