(data stored in ACNUC7421 zone)

EMBL: CP001115.PE133

CP001115.PE133       Location/Qualifiers
FT   CDS_pept        180181..180882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01030"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47525"
FT                   /db_xref="GOA:C1D286"
FT                   /db_xref="UniProtKB/TrEMBL:C1D286"
FT                   /protein_id="ACO47525.1"
FT                   /translation="MTSTAPSSLTESTGSAKHSVRSHLLLPFVAYFLMLASTSFIAGGI
FT                   VHLGLGENTTFYMALAAVGVVCFTAGNYLQEYVIRKNERGTALGKFLLVSFVLSVGIGM
FT                   MTGGVQHFLDNPPYSTILIPSGLLLAVTAFAMREGLTLGRKVTQLISGTLAVAALLFGG
FT                   LSALSTSVSAPAAHGHGAAAEEVTPNVSAAQHSAVDAPETAATPVEAEEAAHPVTDAAD
FT                   GHESEDSHAGH"
     gtgacttcaa ccgcccccag ttccttgacc gaatccaccg gctctgcaaa acattccgtc        60
     cgcagtcacc tgctgcttcc cttcgtcgcg tacttcctga tgctggcgtc caccagcttc       120
     atcgcgggcg gcatcgtgca cctgggactg ggagagaaca ccaccttcta catggccctc       180
     gccgctgtgg gcgtggtgtg cttcaccgcc gggaattacc ttcaggagta cgtcatccgc       240
     aaaaacgagc gcgggaccgc cctgggcaag ttcctgctgg tgtcgttcgt gctgtccgtg       300
     ggcataggca tgatgaccgg aggcgttcag catttcctgg ataacccccc atactccacc       360
     attctgatcc ctagcggcct gctgctggct gtgacggcgt tcgcgatgcg tgaaggcctc       420
     acgttggggc gcaaagtcac gcaactgatt tcagggacgc tggctgtggc ggcgctgctg       480
     tttggcggcc tcagcgcgct gtccacatcg gtgagcgcgc ccgctgccca tggccatggc       540
     gcagcagccg aggaagtcac ccccaacgtg tccgccgcac agcattccgc ggtagacgct       600
     ccggagaccg cagccacccc tgtggaagcc gaggaggcag cgcacccggt gactgacgca       660
     gcagacggac atgagtctga agacagccac gccggccact ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page