(data stored in ACNUC7421 zone)

EMBL: CP001115.PE135

CP001115.PE135       Location/Qualifiers
FT   CDS_pept        181846..182058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01045"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26554"
FT                   /db_xref="GOA:X5GY75"
FT                   /db_xref="UniProtKB/TrEMBL:X5GY75"
FT                   /protein_id="AHX26554.1"
FT                   /translation="MSRGVSRALRLLVLGINLLVLAWITWSGELTPQLALPFLLIFLGI
FT                   ALWRIPSAGKAFVEGRKDSLPRRED"
     atgtcacgtg gtgtgagccg tgcccttcga ctcctggtgt tgggaatcaa tcttctggtg        60
     ctggcctgga taacgtggtc gggagagctg acgccacagc tcgcgcttcc gttcctgctg       120
     atcttcctgg gtattgcact ctggaggatc cccagcgccg ggaaggcgtt cgttgaaggt       180
     aggaaagatt ctctaccgcg acgggaggac tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page