(data stored in ACNUC7421 zone)

EMBL: CP001115.PE136

CP001115.PE136       Location/Qualifiers
FT   CDS_pept        complement(182764..183069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01050"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47527"
FT                   /db_xref="UniProtKB/TrEMBL:C1D288"
FT                   /protein_id="ACO47527.1"
FT                   /translation="MEDAAALLMSEWRYDTHPPYQSEKRTMSAAFEITQEDLRAALDRL
FT                   NLPADETTLERAAEVAFAENERITKAALCGEHLEEQTRCGMDELVAVLSETLGAGG"
     gtggaggacg cggccgcgct cctcatgtca gagtggcggt atgacacgca ccccccctat        60
     cagtccgaga agcgaacgat gagcgccgct ttcgaaatca cgcaggaaga cctgcgtgcc       120
     gcactggacc ggttgaacct gccggcagac gagacgaccc tggaaagggc cgcggaagtg       180
     gcctttgctg agaatgaacg catcacaaaa gcggcgctgt gtggcgaaca tctggaggag       240
     cagaccaggt gcggcatgga tgaattggtg gcggtgctca gcgagacgct gggagcgggc       300
     ggataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page