(data stored in ACNUC7421 zone)

EMBL: CP001115.PE137

CP001115.PE137       Location/Qualifiers
FT   CDS_pept        183318..183950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01055"
FT                   /product="hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01055"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26555"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5P1"
FT                   /protein_id="AHX26555.1"
FT                   /translation="MHRQWVLPCFTLFVICSGALAQQGPAATSSLLGVPLAPGAIRITD
FT                   AAATREFAGPLRNVASSQSAACTTSEFLVWEGDVGDQVSGSLATQLTARQLTLKVLEAT
FT                   DTEDSASLSFVLTGREGRHAGVMYAGSNSVVLGWCRLAARPTASVPSGLKPAQAPKPAA
FT                   LATAKTSAPPVGDYSCLNADSLVYAFKLSILPGMKYRCKAVRSGRLP"
     atgcatcgac aatgggttct gccatgtttt acccttttcg tgatttgcag cggcgcactc        60
     gcgcagcagg ggcctgcggc gacgtccagc ctgctgggtg tgcctttggc tcccggggcc       120
     attcgtatca ctgatgcggc agccacccgt gagtttgcgg gcccgctgag aaacgtggcc       180
     agttcgcagt cagcagcgtg caccaccagt gagtttctgg tctgggaagg tgacgtagga       240
     gatcaggttt cggggagcct ggccactcag ctcaccgcgc gtcaactgac actcaaagtg       300
     ctggaagcga cggatacgga agacagcgcg tcgctgtcat ttgtgctgac agggcgggaa       360
     ggacgtcatg cgggcgtgat gtacgcaggc agcaacagcg tggtgctggg ctggtgccgt       420
     ctggccgcgc ggccaactgc gagtgttcct tcagggctca aacctgccca ggcgcccaaa       480
     cccgcagctc tggccaccgc taagaccagt gcgccgccgg tgggggacta cagctgcctg       540
     aatgctgact ctttggtgta cgcattcaag ctctcaatcc tgccgggaat gaagtatcgg       600
     tgcaaagcgg taaggtcggg gcgtttgcca tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page