(data stored in ACNUC7421 zone)

EMBL: CP001115.PE138

CP001115.PE138       Location/Qualifiers
FT   CDS_pept        184080..184505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01060"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47528"
FT                   /db_xref="GOA:C1D289"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C1D289"
FT                   /protein_id="ACO47528.1"
FT                   /translation="MWAAFLTELAQPDVTHVMVRAHDGYQACVPLEELMHTDVLLADHM
FT                   NGKPLTPAHGAPLRLIAPQLYGYKSIKHLRRLELLPAPVASPVGRIVSHPRGRVNPEER
FT                   SAVGASHFWRWVYRMQVGGHLRGARALSEQNRRIVRP"
     gtgtgggcgg catttttgac ggaactcgca cagccggacg tcacgcacgt gatggtccgc        60
     gcccacgacg gctaccaggc gtgcgtccct ctggaagaat tgatgcacac cgacgtgctt       120
     ctggccgacc acatgaacgg caaaccgcta acgccggctc atggggcgcc cctgcggctg       180
     atcgcgccgc aattgtacgg gtacaagagc atcaagcacc tgcggcgcct ggagttgctg       240
     cctgcgccgg tagccagtcc tgtggggcgg atcgtctctc acccgcgcgg ccgggtgaac       300
     ccggaagaac gcagcgcggt cggcgcttcc cacttctggc ggtgggtgta ccgcatgcag       360
     gtcggcgggc atcttcgtgg ggcccgcgcg ctttcggaac agaatcgccg tatcgtccgg       420
     ccctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page