(data stored in ACNUC7421 zone)

EMBL: CP001115.PE139

CP001115.PE139       Location/Qualifiers
FT   CDS_pept        complement(185027..186304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01070"
FT                   /product="putative major facilitator superfamily MFS_1;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47529"
FT                   /db_xref="GOA:C1D290"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1D290"
FT                   /protein_id="ACO47529.1"
FT                   /translation="MTTPAASPDAFAALRFADFRRLLVSSASASFAGTAFSVVIGYQVY
FT                   ALTKSPLILGLLGVATALPTLSLALLGGHYADRLDRRRILLVTRALLVLSGLAFAGLSL
FT                   AGPATSVTGLFLLVVLMGFARGFGDPASSAFETRIVPARVYVNASAWLGSVGQVAGILG
FT                   PVLAGLFLTRFEASGTYMLMATLYATSWFALRRMPRIPPVMTVSEEGMRESIQGGLRFV
FT                   RKDPVLFGSMALDLLAVLFGGAVALLPVFASDILKVSPSGLGMLMAAPSVGALLVMLWM
FT                   TRKPPLHRTGVWLVLSIAGFGLAMLVFGVSRTFWLSWTALAFSGVFDGVNMLIRRAIVR
FT                   TRTPDHMRGRVGSVSLVFIGTSNEIGALESGVAAHYLGVVRATALGGLITLAIAGGAAW
FT                   RWRDLMAWELRHEQAYHSDTSGVDST"
     atgacgaccc ctgccgcctc tccagatgcc ttcgctgcgc tccgtttcgc ggacttccgg        60
     cgtctgcttg tatcctccgc cagcgcgtcg tttgctggca cggcgttttc cgtcgtcatc       120
     gggtaccagg tgtacgccct taccaaaagc ccgctgatcc tcggcctact tggcgtcgca       180
     acggccctac cgaccctgag tcttgcgctg ctgggcgggc attacgctga ccgcctggat       240
     cgccgccgca tactgcttgt gacgcgtgca ctgctggttc tcagcggtct ggcattcgcg       300
     ggcctctctc tggccgggcc ggcaaccagt gtgactggcc tgtttcttct ggtcgtgctg       360
     atgggattcg cgcggggctt cggggatccg gcttccagtg cgttcgaaac ccggatcgtg       420
     ccggccagag tgtacgtgaa cgcgtccgcg tggttgggca gcgtaggtca ggtggctggg       480
     attcttggcc ccgtactggc ggggctattc ctgacgcgtt tcgaggcgag cggcacgtac       540
     atgctgatgg ccacgctgta tgccacgtcc tggttcgcgc ttcggcggat gccgcgcatc       600
     ccaccggtca tgacggtcag tgaggagggc atgcgcgaga gcatccaggg ggggttgcgc       660
     tttgttcgga aggacccggt gctgttcggc tccatggccc tggacctcct cgccgtgctg       720
     ttcggcggcg cggttgccct gctgcccgta ttcgcctcag atatcctgaa ggtcagccca       780
     agtggtctgg gcatgctgat ggccgcaccc tccgtcggcg cgctacttgt gatgctctgg       840
     atgacccgga agcccccgct gcaccgcacg ggtgtgtggc tggtgctgag catcgcgggg       900
     tttggactcg ctatgttggt gttcggagtg tcccgaacgt tctggctgtc gtggacagcc       960
     ctggctttca gtggcgtgtt cgacggtgtg aacatgctga tacgccgcgc gatcgtgcgc      1020
     acgcgcaccc cggaccatat gcgtggccgt gtcggctcgg tcagcctcgt gtttatcggc      1080
     acgagtaacg agatcggcgc gcttgagagc ggtgtggcgg cgcactacct gggggtcgtg      1140
     cgcgccaccg cgctgggcgg cctgatcaca ctggccattg cgggcggggc cgcgtggcgc      1200
     tggcgggatc tgatggcctg ggagctgcga cacgaacagg cgtatcacag cgacacctca      1260
     ggcgtcgaca gcacctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page