(data stored in ACNUC7421 zone)

EMBL: CP001115.PE14

CP001115.PE14        Location/Qualifiers
FT   CDS_pept        22902..23384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00110"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47404"
FT                   /db_xref="GOA:C1D1W5"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1W5"
FT                   /protein_id="ACO47404.1"
FT                   /translation="MTLPEFFTTLLTELAWNLAVWLPTALVSLLFIRAVLGVRMRELIV
FT                   EIEEHQTAAIGAVFFWVSLGFSLLLSRTIADPVAAGGGTWAEAFAWLALAVLVTMLLFA
FT                   LGVFLVFGTLARRRKESLLGYIRREMRHEHNLALSFIMGALFLVPVVVTYHLTLSS"
     atgaccctgc ctgaattttt caccaccctg ctgaccgagc ttgcctggaa cctcgcggtc        60
     tggctgccga ccgccctggt cagcctgctg tttatccgcg ccgtcttggg cgtgcggatg       120
     cgggaattga ttgtggaaat cgaggaacac cagacggccg ccatcggtgc cgtgttcttc       180
     tgggtatctc ttggcttcag cctgcttctg agccgtacca ttgccgatcc cgtggctgct       240
     ggaggaggaa cctgggcaga agctttcgca tggcttgcct tggccgtcct ggtgacgatg       300
     ctgctgtttg cactgggcgt gttcctggtg ttcggtacgc tggcccgccg tagaaaagaa       360
     agcctgctgg gctatatccg gcgcgaaatg cgccacgagc ataacctggc cttgtcgttc       420
     atcatgggag cactctttct ggtgcctgtc gtggtgacct accaccttac gttgtcttcc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page