(data stored in ACNUC7421 zone)

EMBL: CP001115.PE140

CP001115.PE140       Location/Qualifiers
FT   CDS_pept        187049..187438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01071"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47530"
FT                   /db_xref="UniProtKB/TrEMBL:C1D291"
FT                   /protein_id="ACO47530.1"
FT                   /translation="MSWNCSVMRSKRSRGYWGCQPPTSKGIVGAWPSAAVPPKTAGRQK
FT                   VHRLCTARDEPFQTASHGLDSAAFLSEMEDLPLYLRPSALFTGSTPTGTADLASQDRGL
FT                   RARLERGRCGVKAGSGKGSIGMSAS"
     atgtcctgga actgcagtgt catgcggtcg aagcgctcaa ggggctactg gggctgtcag        60
     ccacccacca gcaaaggcat cgttggcgcc tggccgtcag cagccgtgcc gcccaaaact       120
     gctggtcggc aaaaggtcca ccggttgtgt accgcccgcg atgagccttt tcagaccgca       180
     tctcacgggt tggacagtgc cgcgttccta tcggagatgg aggacttacc actatatctg       240
     cgaccgtcgg cgttgtttac aggatccacg ccgaccggca cggccgacct cgcctctcag       300
     gatcgtggtc tgcgtgcgcg gcttgaacgc ggccggtgcg gcgtgaaggc tggcagcgga       360
     aagggcagca tcggcatgag cgcttcataa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page