(data stored in ACNUC7421 zone)

EMBL: CP001115.PE141

CP001115.PE141       Location/Qualifiers
FT   CDS_pept        complement(187345..187884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01072"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01072"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47531"
FT                   /db_xref="UniProtKB/TrEMBL:C1D292"
FT                   /protein_id="ACO47531.1"
FT                   /translation="MLLKSPTSADDPYPHAAYLAVTAYGEVIGVALGHPGSTLVLHITP
FT                   ELAIPGQFTLQPHNVPAGRQAPALVCHTPQGLPAVARQKRAGYFAVTCYAERPDRLCFD
FT                   AVYEAWIWKRLQAMAASPSNASRLACCAELSGPGGEAPSARSSGHYEALMPMLPFPLPA
FT                   FTPHRPRSSRARRPRS"
     atgcttctga agtcccccac atcagctgac gatccctacc cgcacgcggc gtacctcgcc        60
     gtgaccgcgt acggtgaagt gattggcgtg gccctggggc atccaggaag cactctggtg       120
     ctgcacatca cgcctgagct tgccatccca ggtcagttca cgctgcagcc ccacaacgtg       180
     cctgcaggcc gtcaggcgcc agccctcgtg tgccacactc cccaggggtt gccggcggtt       240
     gcccggcaga aacgcgctgg ttattttgcc gtaacctgtt atgcggagcg tccagaccgg       300
     ttgtgtttcg acgcagtgta cgaagcctgg atctggaagc ggttgcaggc catggcggca       360
     agtcccagta acgcatcccg cctcgcttgc tgtgcagagc tctcaggacc tgggggtgag       420
     gctccgtccg cgcgctccag tggccattat gaagcgctca tgccgatgct gccctttccg       480
     ctgccagcct tcacgccgca ccggccgcgt tcaagccgcg cacgcagacc acgatcctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page