(data stored in ACNUC7421 zone)

EMBL: CP001115.PE142

CP001115.PE142       Location/Qualifiers
FT   CDS_pept        188020..188367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01073"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01073"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47532"
FT                   /db_xref="UniProtKB/TrEMBL:C1D293"
FT                   /protein_id="ACO47532.1"
FT                   /translation="MKQRLFLFVATGLLFASCAPVTVRIITWDHVPSEYLYDQSLMFLN
FT                   TRGYTLKTANKTLSLLEAEITNTAGQATDQATIWIRPAGWSPRIDATFTSGAINEYRGY
FT                   MAQAVARYRHR"
     atgaaacagc gcctgttcct gttcgtcgca actgggctgc tcttcgcttc ctgcgcccca        60
     gtaaccgtgc gaattatcac gtgggaccat gtgccgtcag aatacctgta cgaccagtcg       120
     cttatgttcc tgaacaccag aggatatacg ctgaaaaccg caaacaagac cctgtccctc       180
     ctggaggccg agatcacgaa tacggcgggg caggccactg atcaagccac catctggatt       240
     cggccagccg gctggtcacc ccgcatcgat gcgaccttca cctcaggggc catcaatgag       300
     taccgcgggt atatggccca agcagttgcc aggtaccgcc accggtaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page