(data stored in ACNUC7421 zone)

EMBL: CP001115.PE144

CP001115.PE144       Location/Qualifiers
FT   CDS_pept        189053..190105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47536"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C1D297"
FT                   /protein_id="ACO47536.2"
FT                   /translation="MRFYPRFVSLLGLTLVLTACTQPTTPPPLTGAPPVDTPVITLPTG
FT                   RVLTVGIGKAYSTVRAAVAASQDGDTIRVDPGTYTNDFFEINTRITIESTSGLARLVAT
FT                   VAPPNGKAIITTNTDVTLRGLELTGAKVADRNGAGVRYQGGHLVIEDSYLHGNENGLLA
FT                   ASAPAGSIRITRTEFARNGLGSPGQTHNLYVNEVGQVIFDRSYSHSAVVGHEFKSRART
FT                   TIITNSRLFDLDETASYSIDVPNGGHLTVTGNVIEQGARSQNAFIVSYGTEGLLRDGLN
FT                   VTISDNTVINRRSSGLGILNPGKVPMTVSNNTLFGISVPQFLNGTTGTVTGNMTTTNQP
FT                   TLDTSHPFTR"
     atgcgtttct atccccgttt cgtttccctg ttgggcctga cactcgtcct tacagcatgc        60
     actcaaccta caacccctcc cccactcacg ggagccccgc cagtcgacac gcctgtgatt       120
     accctgccta ccggtcgcgt gctgacggtc ggaattggca aagcatattc gaccgtccgt       180
     gcggcggttg ctgcttccca ggacggcgac acgattcgtg tagatccagg cacatacacc       240
     aatgactttt ttgagatcaa tacccgaatt actatcgaga gcaccagcgg tctggcacgg       300
     ctcgtcgcca ctgtagcgcc gcctaacggc aaggcgatta tcactacaaa cacggatgtg       360
     acgttgcgtg gtctggaact tactggcgca aaggttgcgg accggaacgg tgctggggtg       420
     cgttatcagg gtggtcacct ggtaatagaa gacagctacc tgcacggcaa cgaaaatggt       480
     ttgttggccg ccagcgctcc agctggcagc atccgtatca cccgcaccga gttcgcgcgc       540
     aatggcctcg ggagcccggg ccaaacgcac aacctgtacg tcaatgaggt aggtcaggtg       600
     atcttcgacc gcagttattc gcacagcgct gtcgtgggcc acgaattcaa gagccgtgcg       660
     cgcaccacaa tcatcacgaa cagtcgcctg ttcgatcttg atgagaccgc aagctatagc       720
     attgacgtgc cgaacggtgg acaccttact gtgacgggca acgtcatcga gcaaggtgcc       780
     agaagccaga acgcctttat cgtttcctac ggcacagaag gattactgcg cgacggtctg       840
     aatgtaacga tctcggacaa cacggtgatc aatcgcagat caagtgggct gggcatcctg       900
     aatccaggta aagtaccgat gacggtatcc aacaacacat tgttcggcat ctcggtgcct       960
     cagttcctga atggcacgac cggaacggtc acaggcaata tgacgaccac gaaccagccg      1020
     acgctcgata cctcacatcc ctttacccgt tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page