(data stored in ACNUC7421 zone)

EMBL: CP001115.PE145

CP001115.PE145       Location/Qualifiers
FT   CDS_pept        complement(191876..193762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01090"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47537"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C1D298"
FT                   /protein_id="ACO47537.1"
FT                   /translation="MRRPSFALLAITLTLSLVACPRSTTAAERQTSGSQAITGDTVTGV
FT                   DPAVEPAPGKVVGKATAEGSQSVAGSPQRPPAPESSAAAAPEAASASADVVRSTQEKVK
FT                   AEAQVVKPAPVEVRPATAASTPMRPTPQVTAEARRPAVPVTQASQAKPAVTEPTVVKPS
FT                   PLKAASAQPVQSKSAPAKSVPTKSAPPTPAPARPAPMITSPVETVSAPVASKAVEPAPV
FT                   KPAVIKSVQKPAATHQVAESRRAPGPLQTGPAMRGLWVDAFGPGFKTPGEVDRLIADAR
FT                   AMNINTLFVQAVKRGDCYCNGSLLPRTEDPAVPAEFDPLADVLTKAHAHGIKVHAWVIP
FT                   TAVSNRAVRYPVTNPEHVVNAHGEGDEQDWLMRNSGGSMWAGNDQQLDIGHPDARRYMV
FT                   DAIQSVAAAYNIDGVQLDRVRYPDPSGTVQDWGYNPGAVAAYQAESETTETPAPGDARW
FT                   TAWRREQVNALVSEVSGAVRSARPGTVISVAAITYGAGPRTREAFASTRTYAEVLQDWP
FT                   LWLADGNVDLVVLMNYKREAHAGQARDFDSWNRFAKSVKAGGQVAAGTALYLNTAQENL
FT                   VQVRRAVEQGLDGWVGYSYRTPELGVEEGRKAGDKAYRELRSLLVGESAARH"
     atgcgccgcc cttcttttgc cctgcttgcg atcacgctga ctttgtctct ggtcgcctgc        60
     ccgcgttcca cgaccgctgc tgaacggcag acctccggtt ctcaagcgat caccggggac       120
     acggtgacag gcgtcgatcc agccgtggaa cccgcgccag gcaaggttgt gggcaaggcg       180
     accgcagagg gttcacagag tgtcgcaggc agcccccaga ggccaccagc tccggaaagc       240
     agcgccgcag cggcgcctga ggccgccagc gcgtcagcgg acgtggttcg gagcactcag       300
     gagaaagtga aggctgaagc gcaggttgtt aaaccagcgc ctgtagaagt caggccggcc       360
     acagcagcat ccacgcccat gcgacccact cctcaggtga cggccgaggc gcgcaggcct       420
     gcggtaccgg tgactcaggc ctcacaggcc aagcccgccg tgacagaacc caccgtggtc       480
     aagccgtctc ccttaaaggc cgcttccgcc cagccagttc agagcaagtc tgcgcctgcc       540
     aagtctgtgc ccaccaagtc agcgcccccc actcccgctc cagccaggcc cgcacccatg       600
     atcaccagtc ccgtggagac cgtgtctgct ccagtggcca gtaaggcggt ggagcccgcc       660
     cccgtcaagc ccgcggtgat caagtctgtg caaaagccag cagcaacgca ccaggtggcc       720
     gagtccaggc gggcgcctgg accactccaa accgggcccg cgatgcgcgg cctctgggtt       780
     gacgccttcg gacctggttt caagactccg ggtgaagtcg atcgtctgat cgcagacgcg       840
     cgggccatga acatcaacac gctgttcgtt caagcggtca agcgtggtga ctgctactgc       900
     aatggaagcc tgctgccccg caccgaagat ccggcggtgc ccgcggaatt tgacccgctg       960
     gccgatgtgc tgaccaaagc ccacgcccac ggcatcaagg ttcatgcctg ggtgattccc      1020
     acagcggtgt ccaaccgcgc ggtccgctac ccggtgacga atcctgaaca cgtggtcaac      1080
     gcccacgggg aaggcgacga gcaggactgg ttgatgcgca actccggggg ctctatgtgg      1140
     gcagggaatg accagcagct ggacatcggt catcccgatg cacgccgcta tatggtcgat      1200
     gccattcaaa gcgtggcagc ggcctacaac atcgatggtg tgcaactcga ccgcgtgcgc      1260
     taccccgatc cgtcgggcac agtgcaggac tggggctaca acccgggtgc cgtggcggcg      1320
     taccaggctg agagcgaaac aaccgagacg cctgctccgg gcgacgcgcg ctggacagcc      1380
     tggcgccgcg agcaggtgaa cgcgctggtc tcggaagtct ccggcgccgt gcgcagcgca      1440
     cgccctggaa ctgtgatcag cgtggctgcc attacctatg gcgctggacc caggacccgt      1500
     gaagcttttg cgagcacccg cacgtacgcc gaagtgcttc aggactggcc gttatggctt      1560
     gctgacggaa acgtcgacct ggtggtgctg atgaattaca agcgcgaagc gcacgccggt      1620
     caggcccgcg actttgacag ctggaaccgc tttgcgaaat cggtcaaggc tggtggtcag      1680
     gtagcggctg gcacggcgct gtacctcaat acagcccagg agaacctggt gcaggtgcgc      1740
     cgcgccgtag agcaggggct ggacgggtgg gtggggtatt cctaccgcac gccggaactg      1800
     ggtgtggagg agggccgcaa ggccggggac aaggcgtacc gcgagctccg cagcctgctg      1860
     gtgggggaga gtgcggcgcg gcactga                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page