(data stored in ACNUC7421 zone)

EMBL: CP001115.PE146

CP001115.PE146       Location/Qualifiers
FT   CDS_pept        194572..195231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01096"
FT                   /product="hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01096"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26556"
FT                   /db_xref="UniProtKB/TrEMBL:X5HLK7"
FT                   /protein_id="AHX26556.1"
FT                   /translation="MKPGPLLAVILSALLSACAPGGINQLKFQPAPEGARISAPRLLIE
FT                   QRVPATQLVSVRDAVDRAPVGSLIVVCSERWSAARPWGICTHVTRKLGPDEFTDAPGIF
FT                   VGGLFGGGPQITPARTLFQRDVVIVLDVGVRNHHLNVLRATARKLAGTPYRVAGLLDRD
FT                   GGLDCSTYQNELQRAMGLADAVPFNGLWNLYLPQDALTAPGAQVLWVGVRTLPSKP"
     gtgaaacccg gacccctgct ggctgtcatc ctgagtgcgc tgctgagcgc ctgcgcgcca        60
     ggaggaatca accagctgaa gtttcagcca gcgccggaag gagcaagaat ttccgcccca       120
     cggctcctga tcgagcagcg cgttcctgcc acacagctgg tgagtgttcg agacgcagta       180
     gaccgcgcac cggtcggcag tctcatcgtg gtgtgcagcg aacgctggtc tgcagcgcgt       240
     ccgtggggca tatgcactca cgtgacgcgc aaactcggac cggacgaatt cacggatgcg       300
     cctggcattt tcgtcggcgg cctgttcggc ggtgggccgc agatcacccc tgcccgcacc       360
     ttgtttcagc gtgacgtggt gattgtgctg gacgtggggg tgcgcaacca tcacctcaat       420
     gtcctgcggg ctacggcacg gaagcttgcc ggaactccat accgcgtggc tgggctgttg       480
     gacagagatg gcggactgga ctgttcgacc taccagaatg aactgcagcg ggcgatgggg       540
     ttggcggatg cggtgccgtt caacggtttg tggaacctgt atctcccaca ggacgcactg       600
     acggccccag gggcccaggt cctgtgggta ggcgtgcgaa ctcttccatc caagccctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page