(data stored in ACNUC7421 zone)

EMBL: CP001115.PE148

CP001115.PE148       Location/Qualifiers
FT   CDS_pept        complement(196984..198987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01110"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47540"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2A1"
FT                   /protein_id="ACO47540.2"
FT                   /translation="MARLRTPAGHSLEPATTSFAVREMQAAYIDPPGGITAHPDVLEVV
FT                   LRTMDEVLSEVMHQAEHDEALSPQQQGELIGGVQLGQTLAVALRGYAADPTAERLEMVN
FT                   DLTVTLAQRHVLGNFMMARLPAINAASVLREMTPVPLLEVEFNQATRVVLDAHDQDVGE
FT                   TALLRLTWAGYRAPGLPKNPWAPSRAELTPRPTMDPTRFGWDQELKAIARSPHPAERHA
FT                   ALLLLHINGRDRAENLPLVQVLDQTSVLLYDLQRLARRERNAFPALDQLMTVHDGLAAE
FT                   LGHPDLSMTRRHKRSAAEPHTHDRTAQRLLRALRYERHRTATAAEQGQQARLWEALNQL
FT                   EQELQAGMTPDQDEALKVRLLLLGLQGLTSTYRAPGMNLPVMVQLAAQVSGLDPLWAWQ
FT                   RTQPGDADAPVLRELLAALEDSLFLTALQRSPDWPAWAPRIRRSVTLAAGHLLATVRRR
FT                   GLRLPDQTFLETWFATFGPLRATPLTHHELEAADRERTALILETHGALQTLLKPSDGLP
FT                   ESVVEALEPVRTSTPAAPEPAAVQPLPAALPHIQAARDLLRGRRMVLLGGVPSPHHHAA
FT                   LVEALALEDLDWIGSDQYAHGTHAQSHIRPGTALVVLAIRWMAHAHNTLRDVARERGVP
FT                   YVMHPGGLSPSSVAWQILQQASRQLAPDRPAF"
     atggcccgcc tccggacacc tgccggacac tcccttgaac ctgcgacgac gtcgtttgct        60
     gttcgggaga tgcaggcagc ttacatcgac ccaccgggtg gaatcacggc ccatcctgac       120
     gtcctggagg tcgtgctgcg caccatggac gaggtactga gcgaggtgat gcaccaggcg       180
     gagcatgacg aggccctgtc gccacagcag caaggcgaac tgatcggagg cgtacagctg       240
     ggccagaccc tggctgttgc ccttcgcggc tacgcagccg atccgacggc agagcggctc       300
     gaaatggtca acgacctgac cgtgactctg gctcagcgac atgtgttagg caacttcatg       360
     atggccaggc ttccagccat caatgcagcg tctgtgctga gggagatgac cccagtgccg       420
     ctgcttgagg ttgagttcaa tcaggccacc cgggtggttc tggacgccca cgatcaggac       480
     gttggggaaa ctgcactgct ccgcctgacc tgggccgggt accgtgcgcc tgggcttcct       540
     aaaaacccct gggcacccag ccgggccgag ctgacgccgc gcccgaccat ggatccgacc       600
     cggtttggct gggaccagga actgaaggct atcgcccgca gtccccatcc ggccgagcgg       660
     catgcggcgc tcctactgct tcacatcaat gggcgcgacc gggccgagaa tctcccgctg       720
     gtgcaggtgc tggaccagac cagcgtgctg ctttacgacc tgcagcgtct ggcccggcgt       780
     gagcggaatg cattccctgc gctggatcaa ctcatgacgg tccacgacgg tctggcggcg       840
     gaactgggtc acccggacct gtccatgacc cggcgccaca agcgctcggc cgctgagccg       900
     cacactcatg accgtaccgc tcagcggctc ctgcgcgcgc tgcgctacga gcgccaccgc       960
     acggccaccg cggcagagca gggtcagcag gcccggctct gggaggctct caaccagctg      1020
     gagcaggagt tgcaggcggg catgacgcca gaccaggacg aggcgcttaa ggtcaggctg      1080
     ctgctgctgg gcctccaggg cctgaccagc acgtaccgtg cgcccggcat gaacctgccg      1140
     gtcatggtgc agctcgccgc gcaggtctcg ggtctcgacc cgttgtgggc ctggcagcgc      1200
     acccagccgg gggatgcgga cgccccggtg ctgcgtgagc tcctggcggc ccttgaagac      1260
     agcctgttcc tgaccgcgct gcagcgcagc cctgactggc ctgcctgggc gccccgcatc      1320
     cggcggagtg tcaccctggc cgcggggcac ctgctggcca ccgttcgcag gcgaggtctg      1380
     cgtctgccgg accagacctt tctcgaaacc tggtttgcga ccttcgggcc gctgagggca      1440
     acgcccctca cccaccacga acttgaggcg gctgaccgtg agcgcacagc cctgatcctg      1500
     gagacgcacg gtgccctaca gacgcttctt aagccgtcag acggactgcc tgaatcagtc      1560
     gtggaggccc tggagcctgt gcggacttcg actccggcgg ctccggagcc cgccgcagtc      1620
     cagcccctgc ctgcagccct gccgcatatc caggcggcac gtgatctgct gcgcggccgc      1680
     cgtatggtgc tgctcggcgg tgttcccagt ccgcatcacc acgctgccct ggtcgaggca      1740
     ctggcgctgg aggaccttga ctggatcggc agcgaccagt atgcccacgg gacccacgcc      1800
     cagtcacata tcaggcccgg aacggccctg gtggtcctgg ccatccgctg gatggcgcat      1860
     gcccacaata ctttgagaga cgtggcgcgt gagaggggag tgccctacgt catgcacccg      1920
     ggggggctgt cgcccagcag tgtcgcctgg cagattctgc agcaggccag ccggcaactc      1980
     gctcctgacc ggcccgcgtt ctga                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page