(data stored in ACNUC7421 zone)

EMBL: CP001115.PE150

CP001115.PE150       Location/Qualifiers
FT   CDS_pept        complement(200307..200759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01121"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01121"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47542"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2A3"
FT                   /protein_id="ACO47542.1"
FT                   /translation="MEKVVLLAALTAGMALAQAATFTLKPATVVAAEVKRENDRTFAQA
FT                   FNYFDVIEAYPHVRAKKVTQPPGNKLLTDLCVNHTRSVLNIPGKPTFSQLSQPVYNVDG
FT                   GVYFMRGSVASRTSSGIRLQRSFWCTMVFQGADDGGTVYVISDMVR"
     atggaaaaag tggtgctgct ggcagccttg acggcgggca tggctttggc tcaggccgca        60
     acttttacgc tgaaaccggc tacggttgtt gcagcggagg tcaagcggga gaacgaccgg       120
     acgtttgctc aggcgttcaa ctactttgat gtgatcgagg cgtaccctca cgttcgcgcg       180
     aagaaagtga cccaaccacc tgggaacaaa ctcctgacgg acctgtgcgt gaatcacacg       240
     cgttctgttc tgaacattcc aggcaagcca acgttctccc agctgagtca gccggtatac       300
     aacgttgatg gtggggtgta cttcatgcga ggttctgtgg cgtcccgaac ctcgtctggt       360
     atcaggttac agcggagttt ttggtgcacg atggtgtttc agggcgcaga cgatggaggc       420
     acggtgtatg tgatcagcga catggttcgc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page