(data stored in ACNUC7421 zone)

EMBL: CP001115.PE153

CP001115.PE153       Location/Qualifiers
FT   CDS_pept        203897..204553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01141"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2A8"
FT                   /protein_id="ACO47547.1"
FT                   /translation="MRMPTLHLIVGLPCAGKTTYSKQLERDQPALRLTLDDWHIRLFGH
FT                   DFTLDFVHPEHDARHQVIEKMMWDVAARALQLGNDVILDFGFWAKSERDDYRTRAAALG
FT                   ADSVVHYLHAPEAVLLSRLADRNARQPQGTFQIPPQNCWSGCTCSKLRRKTNPRTSLLL
FT                   NFAEMLTCRRMLNFHRAPPASPSSQRLRPSGLMPTPARWWTGDHLACRELHPQAG"
     atgcgtatgc caaccctcca tcttattgtt ggtctcccgt gtgcgggcaa aaccacctac        60
     tcaaaacaac ttgaacgtga tcaacccgcg ttgcggctca cgctggacga ctggcacatc       120
     cggctgttcg gccatgactt cacgctggat ttcgtgcacc cggagcacga tgcgcggcat       180
     caggtgatcg aaaaaatgat gtgggatgtg gcggctcgag cgttgcagct cggcaatgat       240
     gtcatcctcg actttggttt ctgggcaaaa agcgaacgtg acgactaccg gacgcgagct       300
     gcagccctcg gcgcggacag cgtcgtgcat tacctgcatg cgccagaagc tgtgctgctg       360
     tcgaggcttg cggacagaaa cgcacggcag ccacaaggaa ccttccagat accaccacaa       420
     aactgctgga gtgggtgcac gtgttccaag ctccgacgga agacgaatcc acgcacatca       480
     cttcttctca acttcgctga aatgctgacc tgccggcgta tgctgaactt ccaccgtgcg       540
     ccccccgcca gccccagttc tcaacgcctt cggccttcag gactcatgcc cacgcctgct       600
     cgctggtgga cgggggacca cctggcatgc cgggaactgc atcctcaagc cggttga          657
//

If you have problems or comments...

PBIL Back to PBIL home page