(data stored in ACNUC7421 zone)

EMBL: CP001115.PE154

CP001115.PE154       Location/Qualifiers
FT   CDS_pept        204432..205226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47548"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013402"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2A9"
FT                   /protein_id="ACO47548.2"
FT                   /translation="MRPPPAPVLNAFGLQDSCPRLLAGGRGTTWHAGNCILKPVDLTEG
FT                   ELCWQAATLAALAPARLRLCTPHLSRHGTYLIEGWAAWTFLPGCHEPGRWDDILQVARE
FT                   LHDALAPLPLPEFLGARRDAWAHADRVAWGEQSIEAYLSIPVVRTLAALRRPVVAPAQL
FT                   IHGDLTGNVLFLDGNTPAVIDLSLYWRPVAYAAGIVVADALVWEGADERLLTTADEWPD
FT                   FAQCFVRALLFRIVTDTLRNHGTVNAQPYERAVELACGLVAR"
     gtgcgccccc cgccagcccc agttctcaac gccttcggcc ttcaggactc atgcccacgc        60
     ctgctcgctg gtggacgggg gaccacctgg catgccggga actgcatcct caagccggtt       120
     gacctcaccg aaggcgaact gtgctggcag gccgcaacac tcgccgcact cgcgcctgca       180
     cgcttgcgcc tctgtacacc tcacctcagt cggcacggaa cgtacctcat tgaaggatgg       240
     gcagcctgga cgttcctccc cggctgccac gagccgggcc ggtgggacga catacttcag       300
     gtagcccgcg aacttcacga cgcgctggca cccttgcccc ttcctgaatt tctgggtgcc       360
     cgccgtgatg cgtgggcaca cgctgaccgc gtggcgtggg gggagcagtc cattgaggct       420
     tacctgagca ttccagtggt ccggacgctg gccgcgctcc ggcgtccggt tgtggctccc       480
     gcccagctga ttcacggcga cctgacgggc aacgtgctgt tcctggacgg gaacactccg       540
     gctgtgatcg acttgtcact gtactggcgt ccggtcgcgt acgccgcggg catcgtggtg       600
     gctgacgcgc tggtgtggga aggggcagac gaacgcctgc tgaccacggc ggacgagtgg       660
     cctgacttcg cgcagtgctt tgtgcgggcg ctgttgttcc ggattgttac agacaccctg       720
     cggaaccacg gcaccgtcaa cgcccagccg tacgagagag cagtggaact ggcctgcggg       780
     ttggtagccc gttga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page