(data stored in ACNUC7421 zone)

EMBL: CP001115.PE156

CP001115.PE156       Location/Qualifiers
FT   CDS_pept        complement(207346..207564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47550"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2B1"
FT                   /protein_id="ACO47550.1"
FT                   /translation="MPGKSLTLKGYLYTEIISDDVFLQRAKDFISEGLRLGQLKPVVSK
FT                   VFKLDDIQEAHRYLESNEQIGKIVVNV"
     gtgcccggca aatcgctaac gctgaagggc tatctgtaca ccgagatcat ctccgacgac        60
     gttttcctgc agcgcgccaa ggacttcatc agcgagggct tgcgcttggg ccagctgaag       120
     ccggtcgtgt ccaaggtctt caagctggac gacatccagg aggcgcaccg ttacctggaa       180
     tcgaacgaac agatcggcaa gatcgtcgtc aacgtctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page