(data stored in ACNUC7421 zone)

EMBL: CP001115.PE16

CP001115.PE16        Location/Qualifiers
FT   CDS_pept        25161..25340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00125"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26542"
FT                   /db_xref="GOA:X5HN58"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN58"
FT                   /protein_id="AHX26542.1"
FT                   /translation="MPTWIRNHRRKITVLSAVLLIVLLGLTGVLTKGVALVLSLMVLTF
FT                   LYKLRQHGTYTVNQ"
     atgcccacct ggattcgcaa ccaccgccgc aagattaccg ttcttagtgc ggtactgctc        60
     attgtcctgc tcggcctgac cggtgtgctc accaagggag tggccttagt cttaagcctg       120
     atggttctga cgttcctgta caaactccgt cagcatggga cgtataccgt gaatcagtga       180
//

If you have problems or comments...

PBIL Back to PBIL home page