(data stored in ACNUC7421 zone)

EMBL: CP001115.PE165

CP001115.PE165       Location/Qualifiers
FT   CDS_pept        complement(218076..218432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01252"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01252"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47561"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C2"
FT                   /protein_id="ACO47561.1"
FT                   /translation="MLLAPLHNGLFTCKIYATSLRVRGPSTYKKRNQKGIRARNETVYS
FT                   QKGSITGIESCIDLSPNSLYCFSNVPVCCGNRSFSNQVSLFRTGSGLAMAIRTGKSSTA
FT                   RELTLLVSAQGAPA"
     gtgttattgg cgccacttca caacggcctt ttcacctgta agatatacgc aacatcattg        60
     cgcgtcaggg gcccttccac ttacaaaaag aggaaccaaa aggggataag agcaaggaat       120
     gaaacagtgt attctcaaaa aggaagtatt acaggcatag aaagctgcat tgatttgtct       180
     cccaatagtc tttactgctt ctcaaatgtt cctgtttgtt gcgggaacag atctttcagt       240
     aatcaggtca gccttttccg aactggaagt ggtttggcta tggccattcg cacgggcaag       300
     tcctcaaccg cccgtgagct cactctatta gtaagcgccc aaggtgctcc tgcatag          357
//

If you have problems or comments...

PBIL Back to PBIL home page