(data stored in ACNUC7421 zone)

EMBL: CP001115.PE167

CP001115.PE167       Location/Qualifiers
FT   CDS_pept        219631..220329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01254"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01254"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47563"
FT                   /db_xref="GOA:C1D2C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C4"
FT                   /protein_id="ACO47563.1"
FT                   /translation="MTPTLRTNPVTAALLDHPFPDGFCQALAATHHWSGLHASLVLTEY
FT                   RRFLALATSGPAAPSRHVMLAHNLHRSVAPDDWQALLELGGESLLTTWDSSGRQVYTST
FT                   LDRYRATFGHPAPANVWHDPRLTPGRTLNNWLMRHARTLISVTLAGVLALLAVNHVLPA
FT                   GVATLLGFILLAAVWEVPGRQGSATARRAVQSYSPYVTVLGAAAAMYGGGPGNGGSDSG
FT                   CGDGGSGGSC"
     gtgaccccta ccctccgcac caaccctgtc accgccgccc tgcttgacca ccctttcccg        60
     gatggcttct gccaggccct ggcggctacc caccattggt cgggtctaca cgcctctctc       120
     gtgctcaccg agtaccgacg cttccttgcc ctcgcaacca gcggcccggc tgctccgagc       180
     cgtcacgtga tgcttgccca taacctgcac cgaagcgtcg caccggacga ctggcaggct       240
     ctgttggaac ttggcggcga gtcgctactc actacctggg attcatcagg cagacaggtc       300
     tacaccagca cccttgaccg ctaccgggcg acgttcggcc accccgcacc cgccaacgtc       360
     tggcacgatc cccgactcac acctggcagg accctgaaca actggctgat gcgccacgcc       420
     cgcacgctga tcagcgtcac gttggcgggg gtccttgcac tgctcgcggt gaaccatgtc       480
     cttccggcgg gcgtcgccac attgttgggc ttcattctgc tcgccgcggt atgggaagtg       540
     ccgggccgcc agggatcagc cacggcacga cgggcagtgc agtcgtattc tccctacgta       600
     acggtattag gcgcggccgc ggcgatgtat ggcggcggcc ctgggaacgg gggcagtgac       660
     agcggttgtg gtgacggtgg aagcggcggc tcctgctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page