(data stored in ACNUC7421 zone)

EMBL: CP001115.PE169

CP001115.PE169       Location/Qualifiers
FT   CDS_pept        223311..223721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01271"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47565"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C6"
FT                   /protein_id="ACO47565.2"
FT                   /translation="MTAAASAPLDSTHNQQTFDTCIALTLQMIAAIEFSPTLPGTQPTR
FT                   EMILEFAGQVERNAQDIALMSSRASEDVHQQGTEIYTQLCAARNEPLQVAYHALHSAAF
FT                   LGLGGGLTTATMLATVSVALRILANQHGRLTH"
     atgaccgccg ccgccagcgc tccgctggat tccacgcaca accaacagac cttcgacacc        60
     tgcatcgccc ttaccctcca gatgatcgcg gccatcgaat tctcccctac tctccccggc       120
     acccagccca cccgcgaaat gattctcgaa ttcgccggcc aggttgagcg caatgctcag       180
     gacatcgccc ttatgtcctc tcgcgccagc gaggacgtac accagcaggg cactgagatt       240
     tacacccagc tgtgtgcagc cagaaatgaa cccctgcaag tcgcgtatca cgcattacac       300
     agcgccgcat ttctcgggct gggcggtgga ctgacgaccg ccaccatgct cgcgacggtc       360
     agcgtcgccc tccgcattct tgcgaaccag cacggccggc tcacccattg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page