(data stored in ACNUC7421 zone)

EMBL: CP001115.PE171

CP001115.PE171       Location/Qualifiers
FT   CDS_pept        complement(226410..226790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01282"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01282"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47568"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C9"
FT                   /protein_id="ACO47568.1"
FT                   /translation="MSQHSWADNCGAPCFGWSPSQGLRRCGPEELALAWPAGASNLDPE
FT                   DASWRSERRTGQLLHVREGARAGEVAGTVDQAALWWCWWSFARKSVACFSTVTQHHCSL
FT                   LALDFYRSSTPDLPHLRQPLQV"
     atgagccagc actcctgggc tgacaattgc ggagctccat gctttggttg gtccccttcc        60
     caggggctga ggcggtgtgg tccggaggag ctggcgctgg cctggcctgc cggagccagc       120
     aatcttgacc ctgaagatgc gtcatggcgt tcagaacgcc gcaccgggca gttgctgcat       180
     gtccgggaag gggcgcgagc tggggaggtg gcgggaactg tcgaccaggc tgccctctgg       240
     tggtgctggt ggtctttcgc cagaaaaagt gtggcgtgct tcagcacagt cacccaacac       300
     cactgctctt tgctggccct tgatttctac aggagctcaa caccggacct cccgcacctg       360
     cggcagcctc tgcaggtctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page