(data stored in ACNUC7421 zone)

EMBL: CP001115.PE173

CP001115.PE173       Location/Qualifiers
FT   CDS_pept        227933..228322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01285"
FT                   /product="putative small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01285"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47570"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2D1"
FT                   /protein_id="ACO47570.1"
FT                   /translation="MDLFNKGPGQSSTGSNRLLLDMYETPTHVVVDLALPGVKPEDLDV
FT                   QVEGLTVTIRGHYTEHQDQGTRYWYKALPDGEFLYRLTLPVKVASDEVDATLESGLLHL
FT                   YLPKAPEARTRRIEIKRAGDSIAHD"
     atggacctct ttaataaagg tccaggtcaa tcgtcgaccg gttcaaaccg cctgctcctg        60
     gacatgtacg aaaccccgac gcatgtggtg gttgatcttg cgttgcccgg agtgaaaccc       120
     gaggaccttg atgttcaggt cgaaggcctg actgtcacta tccggggaca ctacaccgaa       180
     caccaggatc agggcacgcg gtactggtat aaggctctcc cagacggcga attcctgtac       240
     cgcctgacgc ttcccgtgaa ggttgccagc gacgaagtcg acgccaccct ggaaagcggc       300
     ctcctgcacc tgtacctgcc caaggctccg gaggcccgca cacggaggat tgaaatcaag       360
     cgcgccggtg actccatcgc ccacgactga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page