(data stored in ACNUC7421 zone)

EMBL: CP001115.PE174

CP001115.PE174       Location/Qualifiers
FT   CDS_pept        228337..229473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01286"
FT                   /product="putative PDZ domain containing protease,
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01286"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47571"
FT                   /db_xref="GOA:C1D2D2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2D2"
FT                   /protein_id="ACO47571.1"
FT                   /translation="MIVMTRLILPLLLSSLVLGPVSAQPSPVVAQAPATTAAPAVNSLN
FT                   RILNSVVSISTVQPPGPAGPSSRGWSPFPGTLLPWLGSGTGVLISEQEILTSARLVQGN
FT                   ATVTVTARGGGSVPARVVGINPERDLALLRLERRPAAPLRAAPLGNSDRLTQGQRLIAV
FT                   GLSPSGGFTAQEVTVRSAAARDELTLDTALNAMARGGPLINSAGEVVGLVSGRFGPRLD
FT                   LPFNAGVQGAAVPINSATSVLADLRAGRPSTSGPVQPAEPPARLGVRVVDLAQLPADQK
FT                   HAMKWPASGLLVQDVTPGSPADRAGVRAGHHQQRVGNETVRVGGDVIVSMDGQPVRRFD
FT                   EFRQTLATKAAGSTVTLEVLRNNQSQRLTVTLDPPPAR"
     gtgattgtga tgactcgcct gattctccct cttctgctgt cctcactcgt gctggggccg        60
     gtcagtgcgc agcccagccc tgtcgttgcc caggctccag ccacgactgc tgcgcccgcc       120
     gtcaatagtc tcaaccggat actgaactct gtggtcagta tttccaccgt gcagcctccc       180
     ggccctgctg ggccaagttc acggggatgg agtccttttc ccggaaccct gctgccctgg       240
     cttggctctg ggaccggagt cctgatcagt gaacaggaaa ttctgaccag cgcccgactg       300
     gtgcagggca atgccacggt gaccgtgact gcccgaggtg gcggttccgt accggccaga       360
     gtcgttggca tcaatccaga gcgcgatctg gcgcttctgc gtctggaacg ccgtccggcg       420
     gctccactcc gtgcagctcc tcttggcaac agtgaccggc tcactcaggg gcaacggctg       480
     attgccgttg gcctgagtcc atccggtgga tttaccgcac aggaagttac ggttcgcagc       540
     gccgcagctc gggacgaact gaccctggat acggccctga atgctatggc ccgtggtggc       600
     cctttgatca actctgccgg tgaagtggtg ggactggtca gtgggcgttt cggtccgcgg       660
     ctggatctcc cgttcaacgc tggcgtacaa ggggcagccg ttcccatcaa ttcggccacg       720
     tccgtcctgg cggacctccg cgccggcaga ccgtcaacat cgggcccggt ccagcctgcc       780
     gaaccaccgg cccggcttgg cgtacgggtc gtggatctcg cgcaactccc ggctgatcag       840
     aagcacgcca tgaagtggcc tgccagcggg ctactggttc aggacgtgac gcctggaagc       900
     ccagctgacc gcgcaggcgt gcgagcaggc caccatcagc aacgcgttgg gaacgaaacg       960
     gttcgggtag gtggtgacgt gattgtgtct atggatggtc aaccggttcg acgcttcgac      1020
     gagttccgcc agacactcgc gacaaaggca gctgggtcca cagtgacgct tgaagtgctg      1080
     cgcaacaacc agtcacagcg cttgaccgtc acacttgacc ccccaccagc acggtaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page