(data stored in ACNUC7421 zone)

EMBL: CP001115.PE177

CP001115.PE177       Location/Qualifiers
FT   CDS_pept        complement(232292..233641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01310"
FT                   /product="putative 3-carboxy-cis,cis-muconate
FT                   cycloisomerase (3-carboxymuconate lactonizing enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47574"
FT                   /db_xref="GOA:C1D2D5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2D5"
FT                   /protein_id="ACO47574.1"
FT                   /translation="MSFTPLDSSLYGSLFTSPAMRQVFSDQQHLQRLVDVEVALAQAQA
FT                   TLGLIPPGAAQDIEAAGRTFQPDLPRLQEGLANDGFPIIALLAQLREHLPEDAAGALHF
FT                   GATTQDILDTALVLQLREALNLMDASLHLLVQLLAHLADQHRRTLMAGRTHSQQALPIS
FT                   FGLKVTGWLAPLLRHQARLGELRPRLLVVQFGGAAGTLAALDQQGPAVAAELARILRLE
FT                   EPLMPWHTQRDTLAELGSWLSLVTGSLGKMAQDIILMAQSEVAEVRESSDPARGGSSTM
FT                   PQKSNPIQSELIVAAARANATLLTGLHQALVQEHERATHGWQLEWLTLPQMLGLTAGAL
FT                   DRAVVLAQELEIDAARMRENVATSQGLMMAEAYVFALTPLLGRKAAKDLVRDAVAVTLA
FT                   GGGALGDSLQTLTDAPIDWNALREDQYLGANDALIDRVLHQVDQPARSHR"
     atgagcttta ctcctctgga ctcctcactg tacgggtcac tgttcacgtc gcctgccatg        60
     cgccaggtgt tcagtgatca gcagcacctg cagcgtctgg tggacgtgga agtcgcgctg       120
     gcacaggcgc aggccacgct gggccttatt ccacccgggg cggcccagga cattgaggct       180
     gctggccgga ccttccagcc ggaccttcca cgactacaag aaggcctcgc caacgacggg       240
     ttccccatta tcgcgctgct ggctcagctg cgggaacatc tgccggagga cgcggccggt       300
     gcgctgcact tcggagccac cacccaggac atcctggaca ccgcacttgt gctgcagctg       360
     cgggaggccc tcaacctgat ggatgcgtcc ctgcacctgc tggtgcagtt gctggcgcac       420
     ctcgccgacc agcaccggcg caccctgatg gccggacgaa cccactcgca gcaggccctc       480
     ccgatcagct tcggcctgaa agtgaccggc tggctcgcgc cgctgctccg gcaccaggcg       540
     cggcttggcg aactgcgacc tcgcctgctt gtcgttcagt tcggcggcgc cgcaggaacc       600
     ctcgccgccc tggaccagca gggcccggcc gtggccgctg aactggcgcg gatcctgcgg       660
     cttgaagaac ctctgatgcc ctggcacacc cagcgtgaca cgctggcgga actgggctcc       720
     tggctgtcgc tcgtcaccgg cagtctcgga aaaatggcgc aggacatcat cctgatggct       780
     cagagtgaag tggcggaagt gcgcgaatcc agcgacccgg cccggggcgg ttccagcacc       840
     atgccgcaga aaagtaaccc tattcaaagc gagctgatcg tcgcggccgc ccgggcaaac       900
     gccacgctgc tgaccggact gcaccaggcc ctcgttcagg aacacgagcg cgctacccac       960
     ggctggcaac tggagtggtt gaccctgcca caaatgctgg gtctcacagc cggagcgctg      1020
     gaccgggccg tcgtgctggc tcaggaactc gagattgacg ctgcgcgcat gcgcgagaac      1080
     gtcgcgacct cacagggact gatgatggcc gaagcgtacg tgtttgccct gactcctctg      1140
     ctgggccgga aagccgccaa agacctcgtg cgtgacgcgg ttgccgtcac cctggcgggg      1200
     ggcggagccc tgggcgatag tctccagaca ctcaccgacg cgcccatcga ctggaacgcc      1260
     ttgcgtgaag accagtatct cggcgccaat gacgccctga ttgaccgggt gctgcatcag      1320
     gtcgaccagc ctgcaaggag tcacagatga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page