(data stored in ACNUC7421 zone)

EMBL: CP001115.PE18

CP001115.PE18        Location/Qualifiers
FT   CDS_pept        27130..27570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00131"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00131"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47408"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1W9"
FT                   /protein_id="ACO47408.1"
FT                   /translation="MKVLLTATALLGLGVSAAQPTTSGWPQGSCLHGTTINESGRPLNL
FT                   RALEGHIRQLLQQAKVSPAAVCSSYLNILVQAESLSQQNTRITAHLILAEREVSLTDVK
FT                   RNDAVSRCSLTVTDVVHQDEDFFASAQAVLTRVFARAPQCTR"
     atgaaagtgc tgttgactgc caccgccctg cttggcctgg gagtctcggc ggcacagcct        60
     acaacttccg gttggccgca aggaagctgc ctgcacggca ccaccatcaa tgaaagtggc       120
     cggccgctga acctgcgtgc gctggaaggc catatccggc aactgcttca gcaggccaaa       180
     gtgagcccag ctgctgtctg cagcagttac ctgaacattc tggtccaagc cgagtccctc       240
     agtcagcaga acacacgcat aacggcacac ttgattctgg ccgaacgcga ggtgtccctg       300
     actgatgtca aacgcaatga cgcagtttcc agatgcagcc tcaccgtcac tgacgtcgtc       360
     catcaggatg aagatttctt cgccagcgct caggccgtac tgacacgcgt gtttgcccgc       420
     gctccccagt gcacccgctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page