(data stored in ACNUC7421 zone)

EMBL: CP001115.PE182

CP001115.PE182       Location/Qualifiers
FT   CDS_pept        236896..237783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01360"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47579"
FT                   /db_xref="GOA:C1D2E0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E0"
FT                   /protein_id="ACO47579.1"
FT                   /translation="MNPPADSPQPVRGVLYYIGALLMFAWLDATTKVLTAHYPVPLVAA
FT                   VRYGTQLTLMMALLPRPRRTHLTSTRPGLVAARSVCLVIVTLFMGLALSRLPLAEATSI
FT                   VFIAPLLVALLSGPLLGERLSTGRWLAVIGGFLGVLLIIRPGGQLDVLGVLFALLAALC
FT                   NAAYQLLSRVLNTEKTVNLLYHSALAGAVVFTMIVPFTFGGPPPSLFTALLLLSLGVSG
FT                   GLGHYLFTLAFRDAPASQLAPLTYMQLLWAGVIGLMVFGQLPDAVSLIGMLIIAVSGIS
FT                   VAIRRPGPVLADNS"
     ttgaacccac ctgccgacag tccgcagccg gtgcgcggcg tgctgtatta catcggggcc        60
     ctcctgatgt ttgcctggtt ggacgccacg accaaggttc ttacggccca ctacccggtc       120
     cccctggtgg ctgccgtacg ttacggtacc cagctgacgc tgatgatggc gctgctgccc       180
     cggccgcgcc ggactcacct gaccagcacc cggcctggtc tggtggcggc acgctcggtg       240
     tgtctggtca tcgtgacctt gtttatgggc ctcgcgctct cccggctgcc actggcagaa       300
     gccacatcga tcgtctttat tgcgccgttg ctggtggccc tgctctcagg ccccctgctg       360
     ggcgaacgtc tgtctacagg acgctggctg gccgttatcg gcggctttct cggggtgctg       420
     ctgatcattc ggccgggtgg tcaactggac gtcctgggag tactgttcgc gttgctggcc       480
     gcgctgtgca acgcggccta tcagctgctc tcgcgtgtcc tcaacacgga aaaaaccgtg       540
     aatctgctgt atcactctgc cctggcgggg gccgtcgtgt tcaccatgat cgtgccgttt       600
     acctttggcg gcccacctcc gagtttattc acggcgctgc tgctgctgag cctgggcgtc       660
     agcggtgggc ttggacacta cctgttcacg ctggccttcc gtgacgcgcc ggcctcacag       720
     cttgctcccc tgacatacat gcaactcctc tgggccggtg tcattggcct catggtgttc       780
     gggcagctgc cagacgccgt cagtctgatc ggcatgctga tcatcgccgt gtcgggcatc       840
     agcgttgcca ttcgcaggcc gggtccggtc ctggcagaca attcctaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page