(data stored in ACNUC7421 zone)

EMBL: CP001115.PE185

CP001115.PE185       Location/Qualifiers
FT   CDS_pept        complement(242019..243875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01390"
FT                   /product="putative bifunctional protein : Xylose
FT                   isomerase-like TIM barrel; 4-hydroxyphenylpyruvate
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47582"
FT                   /db_xref="GOA:C1D2E3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E3"
FT                   /protein_id="ACO47582.1"
FT                   /translation="MSRFRKSIATVSLSGTLLEKMQAAAAVGFDGIEIFEHDLLNHPGT
FT                   PAEVRQIAADLNLTITLFQPFRDFEAMPEAYRQRNLDRAERKFDVMCELGAPQILVCSN
FT                   VQDIALNDPARAAADLHAMAERAQARQLLVGYEALAWGRYVNRWRQAWDIVQQADHPAL
FT                   GLILDSFHTLAVGDTLDGLHETVPSDKIFFVQLADSPRKSMDVLSWSRHYRNFPGQGAL
FT                   PVPEFMREVVQAGYQGPLSLEIFNDEFRAASAHLIAHDGLRSLVWVEAEAGATQLPAPP
FT                   EFLGYEFLEFAVDPNSAPALERRVSALGFERRGEHRSKAVTLYQQGNIHLILNSEPDSH
FT                   AADFFQVHGPSVCAICLRVDDAARAMQRAMALLCTAWEERIGEGECRLPALRAPDGMLF
FT                   FFVDDELADRLYRTDFHLSRPPGPGIGLLEVDHVAQAVPPDRLGSFMLFYRTVFGLEPE
FT                   TIHEIPDPYGLVSSLALVSPSRRVAFPVNVSESRRTGTGRFVNALSGAGVHHIAFTTAD
FT                   LQQAVVAVDEKAGELLDIPENYYDDLDARFLLPGEELVTLRRLNLLYDQDSSGTFRQVY
FT                   TNTFEDRFFFEVVQRDGYTGFGAANASVRMNALAARQAARTN"
     atgagccgct tccggaagtc catcgcgacc gtctcgctga gcggcacgct gctcgaaaag        60
     atgcaggcag ctgcggctgt cggattcgac ggaatcgaaa tttttgaaca cgacctgctg       120
     aatcaccccg gcacgccagc agaagtgcgg cagatcgctg ccgacctgaa tctgaccatt       180
     accctgttcc agcctttccg tgatttcgaa gctatgccag aggcctacag gcagcgcaac       240
     ctggaccgtg ctgagcgcaa gttcgacgtg atgtgcgagc tgggggcccc acagatcctg       300
     gtctgcagca acgttcagga cattgcgctg aatgaccccg cccgcgccgc cgccgacctg       360
     cacgcgatgg ctgagcgggc gcaggcgcgt caacttctgg tcggctacga agcgctcgca       420
     tggggccgct acgtgaaccg ctggcggcag gcgtgggaca tcgtgcagca ggccgatcat       480
     ccggcgcttg gcctcattct cgattccttc cacaccctgg cggttgggga caccctcgac       540
     ggcctgcatg aaacggtgcc ttcggacaag atcttcttcg tgcagctggc cgacagccca       600
     cgcaagagta tggacgtgct gtcctggagc cgtcactacc ggaacttccc agggcagggg       660
     gcgctaccgg taccggaatt catgcgtgaa gtggtgcagg cgggatacca ggggcccctg       720
     tcgctggaga tcttcaatga tgagttccgg gcagcgtccg ctcacctgat tgctcacgac       780
     ggattgcggt cgctggtatg ggtcgaggcc gaagcaggag cgactcagct gcctgcccct       840
     ccagaattcc tcggctacga atttctggaa tttgcagtgg atccgaacag tgcgcctgcg       900
     ctggaacgcc gggtgagtgc ccttggcttt gaacgccggg gcgagcaccg gtccaaagca       960
     gtcaccctct atcagcaggg gaacattcat ctgatcctga acagcgagcc cgacagtcac      1020
     gctgcggact tcttccaggt gcatgggccc tcagtgtgcg ccatctgtct gcgggtcgac      1080
     gacgcagccc gcgccatgca gcgcgccatg gctctgctgt gtaccgcgtg ggaggagcgt      1140
     atcggtgagg gagagtgccg cctgcctgcc ctgcgcgcgc cggacggcat gctgttcttt      1200
     ttcgtcgatg atgagctggc cgaccggctc taccgtaccg acttccacct ctcgcgtcct      1260
     cccggtccgg gaattgggct ccttgaagtc gaccatgtcg cgcaggccgt gccgcccgac      1320
     cgactcggca gcttcatgct tttttaccgt acggtctttg ggctcgagcc cgaaaccatc      1380
     cacgaaatcc ccgatccgta cggcctggtc agcagtctgg cacttgtcag ccccagccgc      1440
     cgggtggcgt ttccggtcaa cgtctcggaa agccgccgca ccggtactgg ccggttcgtc      1500
     aatgccctgt caggtgccgg tgttcatcac atcgctttta ccaccgccga ccttcagcag      1560
     gcggtggtgg ccgtggacga gaaggccggc gaactgctcg acatccccga gaactactac      1620
     gatgaccttg acgcccgctt cctgctgccc ggcgaggaac ttgttaccct gcggcgcctg      1680
     aacctgctgt atgaccagga ctccagcgga accttccggc aggtctacac caacaccttc      1740
     gaagaccggt ttttctttga agtggtgcag cgtgacgggt atacgggctt cggagccgcc      1800
     aacgcttcgg tgcggatgaa cgcgcttgcc gcgcggcagg cggccaggac gaactga         1857
//

If you have problems or comments...

PBIL Back to PBIL home page