(data stored in ACNUC7421 zone)

EMBL: CP001115.PE187

CP001115.PE187       Location/Qualifiers
FT   CDS_pept        complement(244966..245766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01410"
FT                   /product="putative transcriptional regulator, IclR family;
FT                   putative Pca regulon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47584"
FT                   /db_xref="GOA:C1D2E5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E5"
FT                   /protein_id="ACO47584.1"
FT                   /translation="MIASPQSADGNRLDDGSGDTIQALVRGLQVIRAFDARHQRMTLTE
FT                   VAGETGLTRATARRCLLTLHQLGYVSWDGKYFGLTPKILTLGYAYLSSTSLPTIVQPAL
FT                   VHLSQQTGASCSACILDSTEAVIVARASPQRFNSTDLGVGSRLPLYCTSLGHVLLAELS
FT                   DEQFEAYLDQTPLVSHTAATLTQAEDVRAAVRLAGTQGFAINAEGLETGLRSISVPLRN
FT                   TLGHVVAAMSATVPVSVASEQEMQDRLLPVLRSQATLLQQMLTA"
     atgatcgcat cacctcaaag cgctgacggg aatcgtcttg acgacggttc aggtgacact        60
     attcaggccc tggttcgcgg tcttcaggtg attcgcgcct tcgatgcaag gcaccagcgg       120
     atgaccctga ctgaagtggc cggagaaacc gggttgacgc gtgccacggc gcggcggtgt       180
     ctgttgaccc tccaccagct cgggtacgtc tcctgggacg ggaagtattt cggactcacg       240
     ccaaaaatcc tgaccctggg ctacgcctac ctctcctcga cttcgctgcc caccatcgtg       300
     caaccagccc tggttcacct cagtcaacag acgggcgcct catgctcggc gtgcattctc       360
     gacagcaccg aggccgttat cgtggcgcgg gcgagccctc aacgcttcaa ctccacagat       420
     ctgggcgtcg gcagccgcct gcccctgtac tgcacttccc tgggccatgt gctgctggcc       480
     gaactgagtg acgagcagtt cgaggcctac ctggaccaga ctccgctggt gtcccatacc       540
     gccgccacgc tgacccaggc tgaagatgtc cgtgcggcgg tccgcctcgc aggtacgcag       600
     ggttttgcga tcaatgctga aggcctggaa accggcctgc gctcgatttc agttcccctg       660
     cgcaacacgc tcggccatgt ggtggccgcc atgagcgcca ctgtgccggt gagcgtcgcc       720
     agcgaacagg agatgcagga ccgtctgctg ccggtgttgc gcagccaggc cacattgctt       780
     cagcagatgc ttacggcctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page