(data stored in ACNUC7421 zone)

EMBL: CP001115.PE188

CP001115.PE188       Location/Qualifiers
FT   CDS_pept        245959..246906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01420"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47585"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E6"
FT                   /protein_id="ACO47585.1"
FT                   /translation="MKRTAFTLALSLCCLASAQGYPTKGINFIVPWSPGGSADLTSRTL
FT                   ASAMSKHIGQDVTVVSRTGGGGAIGHLAISQARPTGYDIGMGTLELVIPSWGKQSGLTI
FT                   SNFTPISLVSINPAAITVAKNSPFKTIGDLVTYIKANPGKLKASGTAKGGSWDMARAGF
FT                   LKTIGVKNSALPWVPSQGSAAAIQELLAGGVDVITVSVAEVGNLVKSGEVRTLAVMGDK
FT                   RHADFKNVPTLKESGINWSFGSFLSVVGPRRLSADVVTKLDEAVKAGMQSPEFKKFMDN
FT                   AGFGVNYKNPAQFRVFLNQQAAKMKDVEEFINSN"
     atgaaacgca ctgcttttac cctcgccctg tccctctgct gccttgccag cgcgcagggt        60
     tatccaacca agggcatcaa cttcattgtg ccctggtcac ccggcggcag cgctgacctg       120
     acttcccgga ccctggcctc ggccatgagc aagcacattg gtcaagacgt caccgtggtc       180
     agccgtaccg gcggcggcgg cgccatcggg caccttgcca tctcgcaggc ccgacccacc       240
     gggtacgaca tcggcatggg caccctggaa ctggtgattc cctcctgggg caagcagtcc       300
     ggcctgacca tctccaactt cactcccatc agcctcgtca gcatcaaccc ggctgccatc       360
     accgtcgcca agaactcccc tttcaagacc atcggcgacc tcgtgaccta catcaaggcc       420
     aacccaggca agctcaaagc ctccgggaca gcaaagggcg gcagttggga tatggcccgc       480
     gccggcttcc tcaagaccat cggcgtgaag aacagcgccc tgccatgggt gccgtcgcag       540
     ggcagcgccg ccgccatcca ggagcttctt gcaggcggag tggacgtcat cacggtcagc       600
     gtcgccgagg taggcaacct ggtgaagagc ggtgaggtgc gcacgctggc tgtcatgggc       660
     gacaagcggc acgctgactt caagaatgtg ccgaccctca aggaaagcgg gatcaactgg       720
     tcgttcggtt ccttcctgtc ggttgtgggc ccccgccgcc tctcggccga tgtggtcacc       780
     aagcttgacg aagcggtcaa agccggaatg cagtctcccg aattcaagaa gtttatggac       840
     aacgcaggct ttggtgtgaa ctataagaac cccgctcagt tccgggtgtt cctcaaccag       900
     caggccgcaa aaatgaagga cgtcgaagag ttcatcaaca gcaactga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page