(data stored in ACNUC7421 zone)

EMBL: CP001115.PE189

CP001115.PE189       Location/Qualifiers
FT   CDS_pept        246996..247451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01430"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47586"
FT                   /db_xref="GOA:C1D2E7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E7"
FT                   /protein_id="ACO47586.1"
FT                   /translation="MEQQEHPAWELGLSLFLIVCGIATWILSASFPQLEDGAPGPALFP
FT                   RLIGAGMILGGAVLSISALKDLRSAHGSLPFLDSRLGLLKVFAAVGIAAMVPLLMPYIT
FT                   LVGGIALAAALFALLIGTDLPRSIGVGLFTALVVYGVFGKLLGVPLS"
     atggaacagc aggagcaccc tgcctgggaa ctgggcctca gcctgtttct gattgtgtgt        60
     ggcattgcca cctggatttt gagcgcttca tttccccagc ttgaggacgg cgcgcccggc       120
     ccagcacttt ttccccgtct tattggggct ggcatgattc ttgggggcgc tgttctgtcg       180
     atttcagccc ttaaagatct gcgctcggcg catggaagcc ttccctttct ggattcgcgc       240
     ctggggctgc tgaaagtctt tgcagctgta gggattgcag ctatggtgcc cctgctgatg       300
     ccgtacatca cgcttgtggg cggtattgcg ctggcggcgg cgctctttgc actgctgatc       360
     ggcacagatc tgcccaggtc aataggcgtc gggctgttca cggctctggt ggtgtacggc       420
     gtgttcggca aactgctggg agtacccctg tcatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page