(data stored in ACNUC7421 zone)

EMBL: CP001115.PE190

CP001115.PE190       Location/Qualifiers
FT   CDS_pept        247448..248995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01440"
FT                   /product="Conserved hypothetical protein, precursor;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47587"
FT                   /db_xref="GOA:C1D2E8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E8"
FT                   /protein_id="ACO47587.1"
FT                   /translation="MNNLLSWESFLALILGSLFGAVFGSIPGLTATLALSLFVPLALFL
FT                   DPSLVLPAVIGISTAAIFAGDIGSITVKIPGTAASAAYSDEINRMGKGSIAYAMGVATL
FT                   PSAVGAMVGVVILMIGAGLLAQFAKQFSSFEYFWLAVLGLVAGIFATQGKLIKGALSLG
FT                   IGVLISTVGLDPTLGYARFSFGSPNMLAGINYVVALIGLFGISELLEQAYKGVLKTEAV
FT                   VSTDDMRAQRRKVQHDYWVRPSLLMLRERGAMMRASLVGTGVGFLPGAGSDLAAWLSSS
FT                   LERMRTRKAQMTSAEVTRQEETVVLAGTASNNAAVAGAWIPAMALGIPGDTLTAIVLGV
FT                   FLIAGITPGPQLFTENRGLVNQIYLAFAVASVVIMPIMGLLAAYGAGYITRIPFRLLMG
FT                   FILGLTVIGAYAINNNPFDIWVMLALGAFGFVLKRGGFPLAQVVLGMVLGPLLEQNFMV
FT                   SVIKVHWNFASFFERPVALILMLATLLIIVFGSRMNHLYQKSIQAPAAGTDVPTGSV"
     atgaacaatc tgctgagttg ggaatccttc ctcgccctga ttctgggcag cctgtttggc        60
     gccgtgttcg gctccattcc tggcctgacc gccacgctcg ccctgagcct gtttgttccg       120
     ctggccctgt tccttgatcc gagtctggtc ttgcctgccg ttatcggcat ttccaccgct       180
     gctattttcg cgggcgacat cgggtcaatt acagtcaaga ttcccggtac ggccgccagc       240
     gctgcgtaca gcgacgagat caaccgcatg ggcaagggca gcatcgccta cgccatgggg       300
     gtcgctaccc tgccgtcagc tgtcggcgcc atggtcggcg tggtcatcct gatgatcggt       360
     gcaggcctgc tcgcccaatt tgccaaacag ttctcttcat tcgaatactt ctggctggct       420
     gtgctgggtc tggtggccgg tatctttgcc acccaaggca agctgatcaa gggcgcgctc       480
     tcgctgggga tcggcgtgct gatctctacc gtcgggctgg acccgaccct cggctacgcc       540
     cgcttttcct tcggctcgcc aaacatgctt gctggcatca actacgtggt cgcgctgatc       600
     ggcctgttcg gtatcagtga actgcttgag caggcctaca aaggtgtgct gaaaacagaa       660
     gcagtcgtga gtacggacga tatgcgtgcc cagcgccgta aagttcaaca cgactactgg       720
     gtgcgtccca gccttctgat gctgcgggaa agaggggcca tgatgcgcgc ttccctcgta       780
     ggaaccggcg tgggcttcct gcctggcgcc ggctccgacc tggcagcctg gctgtcaagc       840
     agcctggaac ggatgcgcac ccgcaaggca cagatgacca gcgcagaagt cacgcggcag       900
     gaagaaaccg tggtgctcgc cggaaccgcc tccaacaatg ccgctgtggc aggcgcctgg       960
     attcccgcca tggcactcgg aattcctgga gacaccctga ccgccatcgt gctcggagtg      1020
     tttctgattg cagggatcac tcccggtcct cagttgttca cggagaaccg cggcctcgtc      1080
     aatcagatct acctggcgtt cgccgtggcc agtgtcgtca tcatgcccat catgggcctc      1140
     ctggcggcct atggcgctgg gtacatcacc cgtatcccct tccggttgct gatgggattt      1200
     attctcggtc tcacggttat tggtgcctac gccatcaaca acaacccctt tgacatctgg      1260
     gtgatgctgg cactgggcgc gttcggattc gtgctcaagc gcggcggctt tccgctcgca      1320
     caggtggtcc tcggcatggt gctgggccca ctgctggagc agaacttcat ggtcagtgtc      1380
     atcaaggtgc actggaactt tgccagcttc ttcgagcggc cagtcgcttt gattctgatg      1440
     cttgccaccc tgctgatcat cgtgttcggc agccgcatga accacctgta tcagaagtcg      1500
     attcaagccc ctgctgcggg gaccgacgtt ccgaccggct cggtctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page