(data stored in ACNUC7421 zone)

EMBL: CP001115.PE191

CP001115.PE191       Location/Qualifiers
FT   CDS_pept        complement(249257..250549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01450"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47588"
FT                   /db_xref="GOA:C1D2E9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E9"
FT                   /protein_id="ACO47588.1"
FT                   /translation="MPPARQSGSSRTGIQVINLLPVAMGVIAVLLALSFFGRVGPALLA
FT                   IILALILATALNPVARFLERWMPRAAAGLATVLLVLAALALLGFLAVPPVVTQVGQISG
FT                   SLPSSVPELEKRINAAIAGYPSISGALSEDTIHGLVQQATTFTTKAARALPNLVGTALG
FT                   GLFLALVTLVMVVFVLSNPVPLVNGALGAVPPRHRLKAARALAQILKQLGAWGRATVLI
FT                   MLVTGGFMALGLMLLGVENWLVFGLLAALGELIPNLGPIVASLPPILFTLADDPQKAVY
FT                   VAVFSLVFQQVEGFILAPFLLGGAGKLHPLSVTVGVLLFGSVFGLVGAFLTVPFLIILK
FT                   AMYQEFYLQDAPDIPDAVAMALISGKVEEQLEREEEEREATVKAAQEARDAELVRQAEE
FT                   GDLDLAEALDAPEGNASTEGRQRAGQGPESV"
     atgccccccg cgcggcaatc aggttcgtca cgaaccggca tccaggtcat caacctgctt        60
     cccgttgcga tgggcgtcat tgccgtgctt cttgccctca gttttttcgg cagggtaggc       120
     ccggccctgc tcgcgatcat tctggcgctg attctggcca ccgccctgaa tccggtcgcc       180
     cggttccttg aacgctggat gccacgtgcc gctgcagggc tggccaccgt gctgctggtg       240
     ctggccgccc tggccctgct ggggtttctt gcggttccac ctgtcgtaac ccaggtggga       300
     cagatttcag gcagtttgcc cagctctgtt ccagagctgg aaaaacgtat caatgctgcc       360
     atcgcaggat atccctccat tagtggggcg ctgtccgaag acactattca cggacttgtt       420
     cagcaggcga ccacttttac gaccaaagca gcccgcgcgc taccaaacct ggtggggacc       480
     gcgctgggcg gcctgtttct cgccctggtc acgctggtaa tggtggtgtt tgtgctgagt       540
     aacccagtgc cgctggtcaa cggggccctg ggtgctgttc cgccccggca ccgcctgaaa       600
     gccgcccgcg ccctggccca gattctcaag caactgggcg cctggggccg cgccaccgtg       660
     ctgatcatgc tggtcacggg cgggttcatg gccctcgggc tgatgttgct cggtgtagaa       720
     aactggctcg ttttcggcct tctggcggcg ctgggggaac tgatacccaa cctcgggccg       780
     atcgtggcgt cgctgccgcc gatcctgttc actctggctg acgatccgca gaaagcggtg       840
     tatgtggcgg tgttctcgct ggtgtttcag caggttgaag ggttcattct ggcgccgttc       900
     ctgctgggcg gtgcgggaaa gctgcatccc ctgtcggtga ctgtcggcgt gctgctgttc       960
     gggagtgtgt tcgggctggt gggcgctttt ctgacggtgc cgtttctgat catcctgaaa      1020
     gcgatgtatc aggagttcta cctgcaggac gctccggata ttccagatgc agtagcgatg      1080
     gcgctgatca gcggcaaggt cgaagagcag ctcgagcgcg aggaagagga gcgtgaggcg      1140
     acggtcaagg ctgcgcagga ggcccgcgac gcagaactgg tgcgtcaggc cgaagaggga      1200
     gatctggacc tcgctgaggc cctggacgcg ccggagggga acgccagtac cgaaggccgt      1260
     cagcgggccg ggcaaggacc agagtccgtg tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page