(data stored in ACNUC7421 zone)

EMBL: CP001115.PE198

CP001115.PE198       Location/Qualifiers
FT   CDS_pept        257501..258253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01520"
FT                   /product="Conserved hypothetical protein, precursor;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47595"
FT                   /db_xref="GOA:C1D2F6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2F6"
FT                   /protein_id="ACO47595.1"
FT                   /translation="MILLSTLLIGLLAGVLGAILGLGGGVVVVPAMEFLLPRLGHPLTI
FT                   GQAVAISQFSVLAVGLAGAASYLQQGLVRARTGYLLSPYTIVGGALGSFLGLVLPARAV
FT                   ATVFAMLLLYSAYTLVRGLKRVEVEREPSRLVPPAMTFAGVMSGLLGIGGGTVQVPVMN
FT                   LLGGLPIRQAIATSTFIMGLTAVGNALIYQAGGLLNAQLACAIAFGVLIGARAGAGLQK
FT                   RIPDRELKIFFAGLVTLTAVQLLYKYWS"
     ttgatcctgc tgtccaccct tctgattggt ctgctggccg gcgtactggg ggccattctg        60
     gggctgggcg ggggcgtggt ggtggttccc gccatggaat tccttctgcc gcgcctgggt       120
     catcctctga ccatcggaca agccgtcgcg atcagccagt tcagtgtgct ggccgtgggg       180
     ctggcgggag cagcctccta cctgcagcag ggcctggtcc gcgcccggac tgggtatctg       240
     ctcagccctt acaccatcgt gggcggggcg ctgggcagtt ttctgggtct ggttctgcca       300
     gcgcgggcgg tcgccaccgt gttcgcgatg ctgctgctgt actcggcgta cacgcttgtc       360
     cgtgggctca aacgcgtgga ggtcgaacgc gaacccagcc gtctggtgcc gcccgccatg       420
     acctttgccg gtgtgatgag cggcctgctg ggcatcggtg gcggcaccgt gcaggtgccg       480
     gtcatgaacc tgctgggcgg cctgccgatc cgtcaggcga ttgccaccag cacgttcatc       540
     atgggtctga ccgccgtggg caacgcgctg atctaccagg caggaggact gctgaatgca       600
     cagctcgcct gcgcgatcgc gttcggagtc ctgatcggcg cccgggccgg tgcaggactg       660
     cagaaacgta ttccagaccg ggaactgaaa atcttctttg ctggactggt gacgctgacc       720
     gccgttcagc tgctctacaa gtactggagt tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page