(data stored in ACNUC7421 zone)

EMBL: CP001115.PE199

CP001115.PE199       Location/Qualifiers
FT   CDS_pept        258256..258528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01530"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47596"
FT                   /db_xref="GOA:C1D2F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2F7"
FT                   /protein_id="ACO47596.1"
FT                   /translation="MKLPTTTTEAGVLSGWVFPWGFRLALPVLLASMLWPQAADAGLWF
FT                   MMGLPAFAAMTVVHRNWSTDRTVSLAALTALGGVLAVVVLKSLLL"
     atgaagctgc ctacaacaac caccgaggca ggtgtgcttt ctggatgggt atttccctgg        60
     ggcttccggc tggcgctgcc ggtgctgctg gccagcatgc tctggccgca agcggcggac       120
     gccggcctct ggttcatgat gggcctgcct gcgtttgctg ccatgaccgt tgtgcaccgg       180
     aactggtcga cagaccgcac tgtcagtctg gctgccctga ccgccctggg tggcgtgctt       240
     gccgtcgtgg tcctcaagag tctgctgctg taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page