(data stored in ACNUC7421 zone)

EMBL: CP001115.PE200

CP001115.PE200       Location/Qualifiers
FT   CDS_pept        258576..259523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01540"
FT                   /product="putative acetamidase/formamidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47597"
FT                   /db_xref="GOA:C1D2F8"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2F8"
FT                   /protein_id="ACO47597.1"
FT                   /translation="MTIIPVPAERLIYAMDRSNAPLVTVPDGSVLTFETRDCFEDQIQD
FT                   AGADFVTLDWTRVNPATGPVFVEGAQPGDALAVEIQHIEIGSQAVMVTGPGLGVEGDVL
FT                   EHPTVRVYPINDGHITMGAVKIPVQPMIGVIGTAPAGDPVPNGTPGPHGGNMDTRLIQA
FT                   GTTLLLPVEVEGGLLAMGDLHAAMGDGEVSVCGLEVPGRVTVRVRVVPQCRWPLPMLHT
FT                   DTHVYTIASAVTLDEAAVMATKQMSAFVQAGTGLSPADAIGLLSAAGNLQISQVVDPLK
FT                   TCRFELSLDILSALGFTPERDIRLAATAGQPAAD"
     atgactatta tcccggtacc ggccgagagg ctgatctacg cgatggaccg ttcaaacgcg        60
     ccgctcgtga ccgtgcctga cggcagcgtc ctgacctttg agacccgcga ctgctttgaa       120
     gaccagatcc aggatgccgg agcggacttt gtcaccctcg actggacccg ggtcaatccc       180
     gccaccggac cggtttttgt tgagggtgcc cagcccggcg acgctcttgc cgtggagatc       240
     cagcacatcg aaatcgggtc acaggctgtc atggtcacgg gtcctggact tggtgtggaa       300
     ggcgacgtcc tggagcaccc cacggtccgg gtgtatccca tcaacgatgg gcacatcact       360
     atgggcgcgg tgaagattcc tgtgcagccc atgattggcg tgatcgggac agcacctgca       420
     ggcgaccctg tgcccaacgg cacgcccggt ccccatgggg ggaacatgga cacccgcctg       480
     attcaggctg gaacgaccct gttgctgccg gtcgaggtgg aaggcggact gctcgcgatg       540
     ggagaccttc atgccgccat gggggacggg gaagtcagcg tgtgcgggct ggaggtccct       600
     ggccgggtca ccgtgcgcgt cagggtcgtg ccccagtgcc gctggcctct gccgatgctg       660
     cacaccgata cgcacgtgta caccattgcc agcgcggtga cgctggacga ggcggccgtg       720
     atggcgacca agcagatgag cgcgtttgtt caggctggga caggcctgtc cccggcagac       780
     gccattggac ttctgagcgc cgctgggaac cttcagatca gtcaggtggt ggatccgctc       840
     aaaacctgcc ggtttgaact gtccctggat atcctgagcg cactgggatt cacccctgag       900
     cgcgatatcc gtctcgcagc gacggctggt cagccagctg ccgactga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page