(data stored in ACNUC7421 zone)

EMBL: CP001115.PE202

CP001115.PE202       Location/Qualifiers
FT   CDS_pept        complement(263358..263525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01560"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47600"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G1"
FT                   /protein_id="ACO47600.2"
FT                   /translation="MNIQSQPEPQTSEDLEVRKARVQQVIDAGGKDDLSEDDYVFAVKN
FT                   ALILDGQVEA"
     atgaacatcc aatctcagcc ggaacctcaa accagcgagg accttgaagt caggaaggcc        60
     cgggtgcagc aggtgatcga cgctggtggc aaggatgacc tttccgaaga tgactatgtg       120
     tttgccgtga aaaacgccct gatcctggat ggtcaggtgg aggcctga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page